BLASTX nr result
ID: Paeonia24_contig00042057
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00042057 (308 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516625.1| conserved hypothetical protein [Ricinus comm... 75 7e-12 ref|XP_002513262.1| conserved hypothetical protein [Ricinus comm... 66 6e-09 >ref|XP_002516625.1| conserved hypothetical protein [Ricinus communis] gi|223544227|gb|EEF45749.1| conserved hypothetical protein [Ricinus communis] Length = 166 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/44 (79%), Positives = 37/44 (84%) Frame = +1 Query: 10 LSPSSRVGAGRSFDQIPLKTVRAGLPACGSRHSRWPSPAFIRKS 141 +SPSSRVG G SFDQ+PLKTV AGLP CGS HSRW SPAFI KS Sbjct: 34 ISPSSRVGVGLSFDQVPLKTVCAGLPTCGSCHSRWSSPAFIHKS 77 >ref|XP_002513262.1| conserved hypothetical protein [Ricinus communis] gi|223547636|gb|EEF49130.1| conserved hypothetical protein [Ricinus communis] Length = 64 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +1 Query: 25 RVGAGRSFDQIPLKTVRAGLPACGSRHSRWPSPA 126 RVG GRSFDQIPLKTVRAG+PACGSRHSRW S A Sbjct: 15 RVGVGRSFDQIPLKTVRAGVPACGSRHSRWSSLA 48