BLASTX nr result
ID: Paeonia24_contig00041498
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00041498 (245 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007213363.1| hypothetical protein PRUPE_ppa026835mg, part... 57 3e-06 gb|EXB51036.1| Subtilisin-like protease [Morus notabilis] 55 8e-06 >ref|XP_007213363.1| hypothetical protein PRUPE_ppa026835mg, partial [Prunus persica] gi|462409228|gb|EMJ14562.1| hypothetical protein PRUPE_ppa026835mg, partial [Prunus persica] Length = 740 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -2 Query: 115 FNSESGTSMACPHVSDIVVLLKTICPDWSPS 23 FN+ESGTSM+CPHVS +V LLKT+ PDWSPS Sbjct: 523 FNTESGTSMSCPHVSGVVGLLKTLYPDWSPS 553 >gb|EXB51036.1| Subtilisin-like protease [Morus notabilis] Length = 732 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -2 Query: 115 FNSESGTSMACPHVSDIVVLLKTICPDWSPS 23 FN+ESGTSM+CPHVS IV LLKT+ PDWSP+ Sbjct: 512 FNTESGTSMSCPHVSGIVGLLKTLHPDWSPA 542