BLASTX nr result
ID: Paeonia24_contig00041383
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00041383 (479 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007027037.1| Uncharacterized protein TCM_021947 [Theobrom... 67 3e-09 >ref|XP_007027037.1| Uncharacterized protein TCM_021947 [Theobroma cacao] gi|508715642|gb|EOY07539.1| Uncharacterized protein TCM_021947 [Theobroma cacao] Length = 174 Score = 67.0 bits (162), Expect = 3e-09 Identities = 42/110 (38%), Positives = 54/110 (49%), Gaps = 24/110 (21%) Frame = -2 Query: 259 MYAEFNYYSFLNMSNSEPFFVQNDQKVTEFKILKIPTLESEEE----------------- 131 MYAEF+ S L+MSNSE F V++D + E I+K P LE EE Sbjct: 1 MYAEFSQVSVLSMSNSEVFLVKDDGEGMELGIVKRPALEFREECAQATASSHNPDKEPQV 60 Query: 130 -------RKCNICCEEVEVEKPGYKEIEVDDNDDGFRTPISLEHKIPTVK 2 E E +KP E + D+DDGF+TP SL+HKIP +K Sbjct: 61 DEEKKGGEPSVTASTESEQKKPCLGEFKAIDDDDGFKTPTSLDHKIPVIK 110