BLASTX nr result
ID: Paeonia24_contig00041010
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00041010 (238 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ELR44476.1| hypothetical protein M91_20944, partial [Bos mutus] 54 2e-11 gb|EGV91149.1| hypothetical protein I79_026257 [Cricetulus griseus] 64 2e-08 gb|AAO61994.1| conserved hypothetical protein [Aster yellows phy... 64 3e-08 ref|XP_002076042.1| GK23686 [Drosophila willistoni] gi|194172127... 62 8e-08 >gb|ELR44476.1| hypothetical protein M91_20944, partial [Bos mutus] Length = 97 Score = 53.9 bits (128), Expect(2) = 2e-11 Identities = 29/42 (69%), Positives = 31/42 (73%) Frame = -2 Query: 231 VMTAFNSQS*TFLLIEQF*NSLFVESASGYVDLFEDFVGNGI 106 VM A SQS TFLLIEQ N+ FVE A GY+D FE FVGNGI Sbjct: 11 VMFACKSQSATFLLIEQLGNTPFVEFAMGYLDFFEAFVGNGI 52 Score = 40.4 bits (93), Expect(2) = 2e-11 Identities = 17/31 (54%), Positives = 24/31 (77%) Frame = -1 Query: 94 KTKQEHSQKLLCDVCVPLQELNFPLDRAALK 2 +++Q++SQKL CDVC+ L E + PLD A LK Sbjct: 56 ESRQKNSQKLPCDVCIQLSEWHLPLDTAVLK 86 >gb|EGV91149.1| hypothetical protein I79_026257 [Cricetulus griseus] Length = 60 Score = 63.9 bits (154), Expect = 2e-08 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -2 Query: 231 VMTAFNSQS*TFLLIEQF*NSLFVESASGYVDLFEDFVGNGI 106 VM AFNSQS TFL IEQ N+LFV+SASGY DLFE FVGNGI Sbjct: 8 VMCAFNSQSLTFLFIEQLGNTLFVKSASGYSDLFEAFVGNGI 49 >gb|AAO61994.1| conserved hypothetical protein [Aster yellows phytoplasma] Length = 58 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -2 Query: 231 VMTAFNSQS*TFLLIEQF*NSLFVESASGYVDLFEDFVGNGI 106 VM AFNSQS TFL IEQF N LFV+SASGY+++FE FVGNGI Sbjct: 8 VMCAFNSQSLTFLFIEQFGNPLFVKSASGYLNVFEAFVGNGI 49 >ref|XP_002076042.1| GK23686 [Drosophila willistoni] gi|194172127|gb|EDW87028.1| GK23686 [Drosophila willistoni] Length = 52 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -2 Query: 228 MTAFNSQS*TFLLIEQF*NSLFVESASGYVDLFEDFVGNGI 106 M AFNSQS TFLL+E+F +++FV+SASGY+DLFE FVGNGI Sbjct: 1 MCAFNSQSITFLLMEEFGDTVFVKSASGYLDLFEAFVGNGI 41