BLASTX nr result
ID: Paeonia24_contig00039976
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00039976 (249 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004308438.1| PREDICTED: uncharacterized protein LOC101291... 37 5e-08 ref|XP_004295685.1| PREDICTED: uncharacterized protein LOC101299... 36 8e-07 >ref|XP_004308438.1| PREDICTED: uncharacterized protein LOC101291974 [Fragaria vesca subsp. vesca] Length = 241 Score = 37.0 bits (84), Expect(3) = 5e-08 Identities = 17/33 (51%), Positives = 22/33 (66%) Frame = +1 Query: 7 NPKFGNWEKLDKMLLGIINNSLTP*SLLAIAKS 105 NP + W D+M+LG INNSLTP L +A+S Sbjct: 100 NPAYQQWISNDQMVLGWINNSLTPPVLATVARS 132 Score = 33.9 bits (76), Expect(3) = 5e-08 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = +3 Query: 189 EMLRTARGDTSISEFLDKIN 248 E+LRT RG+ SIS+FLDKIN Sbjct: 160 ELLRTMRGNMSISDFLDKIN 179 Score = 31.2 bits (69), Expect(3) = 5e-08 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = +2 Query: 125 WVCLEKRFASQYQNRIIDLR 184 W L KRFASQ QNRI+ LR Sbjct: 139 WSSLAKRFASQSQNRILQLR 158 >ref|XP_004295685.1| PREDICTED: uncharacterized protein LOC101299945 [Fragaria vesca subsp. vesca] Length = 235 Score = 35.8 bits (81), Expect(3) = 8e-07 Identities = 18/35 (51%), Positives = 22/35 (62%) Frame = +1 Query: 1 EKNPKFGNWEKLDKMLLGIINNSLTP*SLLAIAKS 105 E NP + W D+M+LG INNSLTP L +A S Sbjct: 109 EVNPAYQQWIANDQMVLGWINNSLTPPVLATVAWS 143 Score = 33.5 bits (75), Expect(3) = 8e-07 Identities = 14/20 (70%), Positives = 18/20 (90%) Frame = +3 Query: 189 EMLRTARGDTSISEFLDKIN 248 E+LRT RG+ SIS+FLDK+N Sbjct: 171 ELLRTMRGNMSISDFLDKVN 190 Score = 28.5 bits (62), Expect(3) = 8e-07 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +2 Query: 122 VWVCLEKRFASQYQNRIIDL 181 +W L K FASQ QNRI+ L Sbjct: 149 IWSSLAKHFASQCQNRILQL 168