BLASTX nr result
ID: Paeonia24_contig00039612
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00039612 (266 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_358634.1| hypothetical protein PhapfoPp088 [Phalaenopsis ... 57 4e-07 >ref|YP_358634.1| hypothetical protein PhapfoPp088 [Phalaenopsis aphrodite subsp. formosana] gi|58802850|gb|AAW82570.1| hypothetical protein [Phalaenopsis aphrodite subsp. formosana] Length = 86 Score = 57.4 bits (137), Expect(2) = 4e-07 Identities = 33/62 (53%), Positives = 39/62 (62%), Gaps = 5/62 (8%) Frame = +1 Query: 79 GTWGCKKQNHINLF*PR-----ATSYFIVKKQKQIYISKFNLDMIHFFLDVK*CQTKIPI 243 G G K++ INL PR A SYF V+K+K+ ISK N D+ FFL VK CQTKIP Sbjct: 23 GDMGTYKRDLINLLRPRIISSWAWSYFTVEKRKKTSISKLNSDVARFFLGVKQCQTKIPN 82 Query: 244 KH 249 KH Sbjct: 83 KH 84 Score = 22.3 bits (46), Expect(2) = 4e-07 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +2 Query: 14 MPKA*DTPSPSFL 52 MPKA +TPS SFL Sbjct: 1 MPKARETPSLSFL 13