BLASTX nr result
ID: Paeonia24_contig00039438
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00039438 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276685.2| PREDICTED: protein SUPPRESSOR OF PHYA-105 1-... 75 9e-12 >ref|XP_002276685.2| PREDICTED: protein SUPPRESSOR OF PHYA-105 1-like [Vitis vinifera] Length = 1072 Score = 75.1 bits (183), Expect = 9e-12 Identities = 39/72 (54%), Positives = 43/72 (59%), Gaps = 1/72 (1%) Frame = -3 Query: 219 MTANDVGSGVECKTKDSDLPL-KLEGHNILGSPGMYVSSGNHWPNCLPHVYADTQEATSL 43 M AN V E K K D PL K EGH +LGSP YVSSG WP LPHVY + + L Sbjct: 1 MDANSVARAAELKRKGLDAPLMKSEGHYMLGSPMKYVSSGGDWPKTLPHVYTNMLGGSGL 60 Query: 42 NRRVTSLAGSEP 7 NR +TS GSEP Sbjct: 61 NRSITSFDGSEP 72