BLASTX nr result
ID: Paeonia24_contig00039414
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00039414 (432 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518969.1| beta-1,3-n-acetylglucosaminyltransferase rad... 56 5e-06 >ref|XP_002518969.1| beta-1,3-n-acetylglucosaminyltransferase radical fringe, putative [Ricinus communis] gi|223541956|gb|EEF43502.1| beta-1,3-n-acetylglucosaminyltransferase radical fringe, putative [Ricinus communis] Length = 538 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -1 Query: 429 SHPITPFISVHHIEAVDPFYPGLSLIKSFLLST 331 SHPI PF+S+HHIEAVDPFYPGLS + S L T Sbjct: 331 SHPIAPFVSIHHIEAVDPFYPGLSSLDSLKLFT 363