BLASTX nr result
ID: Paeonia24_contig00039080
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00039080 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHI59639.1| somatic embryogenesis receptor-like kinase [Paeon... 62 1e-07 >gb|AHI59639.1| somatic embryogenesis receptor-like kinase [Paeonia suffruticosa] Length = 627 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 93 MVVMERGIAASVLVWLILVVHPFTRILANME 1 MV MERGIAASVLVWLILVVHPFTRILANME Sbjct: 1 MVAMERGIAASVLVWLILVVHPFTRILANME 31