BLASTX nr result
ID: Paeonia24_contig00038281
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00038281 (377 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004143469.1| PREDICTED: uncharacterized protein LOC101209... 81 1e-13 ref|XP_006428182.1| hypothetical protein CICLE_v10025180mg [Citr... 79 6e-13 ref|XP_007208440.1| hypothetical protein PRUPE_ppa002799mg [Prun... 79 8e-13 ref|XP_007159648.1| hypothetical protein PHAVU_002G255400g [Phas... 78 1e-12 ref|XP_003531355.1| PREDICTED: uncharacterized protein LOC100816... 78 1e-12 ref|XP_003524266.1| PREDICTED: uncharacterized protein LOC100800... 78 1e-12 ref|XP_006380423.1| hypothetical protein POPTR_0007s05550g [Popu... 78 1e-12 ref|XP_002533208.1| heat shock protein 70 (HSP70)-interacting pr... 78 1e-12 ref|XP_002307091.1| hypothetical protein POPTR_0005s07790g [Popu... 78 1e-12 emb|CAN77716.1| hypothetical protein VITISV_023407 [Vitis vinifera] 78 1e-12 ref|XP_006355353.1| PREDICTED: uncharacterized protein LOC102588... 77 3e-12 ref|XP_007047977.1| ARM-repeat/Tetratricopeptide repeat (TPR)-li... 77 3e-12 ref|XP_007047976.1| ARM-repeat/Tetratricopeptide repeat (TPR)-li... 77 3e-12 ref|XP_004237397.1| PREDICTED: uncharacterized protein LOC101261... 77 3e-12 gb|EXB29432.1| hypothetical protein L484_022103 [Morus notabilis] 75 7e-12 ref|XP_006826923.1| hypothetical protein AMTR_s00010p00170700 [A... 75 7e-12 ref|NP_001055582.1| Os05g0421300 [Oryza sativa Japonica Group] g... 75 9e-12 ref|XP_004504067.1| PREDICTED: uncharacterized protein LOC101505... 75 1e-11 ref|XP_006647288.1| PREDICTED: uncharacterized protein LOC102715... 74 2e-11 ref|XP_004300163.1| PREDICTED: uncharacterized protein LOC101308... 74 2e-11 >ref|XP_004143469.1| PREDICTED: uncharacterized protein LOC101209622 [Cucumis sativus] gi|449532300|ref|XP_004173120.1| PREDICTED: uncharacterized LOC101209622 [Cucumis sativus] Length = 615 Score = 81.3 bits (199), Expect = 1e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +2 Query: 266 MEKVSTDCPYPGCFFCVMKEGNPSKRRACILKFFREL 376 MEKVSTDCPYPGCFFCVMKEGNPSKRRA ILKFFREL Sbjct: 1 MEKVSTDCPYPGCFFCVMKEGNPSKRRASILKFFREL 37 >ref|XP_006428182.1| hypothetical protein CICLE_v10025180mg [Citrus clementina] gi|568819368|ref|XP_006464226.1| PREDICTED: uncharacterized protein LOC102617410 [Citrus sinensis] gi|557530172|gb|ESR41422.1| hypothetical protein CICLE_v10025180mg [Citrus clementina] Length = 615 Score = 79.0 bits (193), Expect = 6e-13 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = +2 Query: 266 MEKVSTDCPYPGCFFCVMKEGNPSKRRACILKFFREL 376 MEKVS DCPYPGCFFCVMKEGNPSKRRA ILKFFREL Sbjct: 1 MEKVSPDCPYPGCFFCVMKEGNPSKRRASILKFFREL 37 >ref|XP_007208440.1| hypothetical protein PRUPE_ppa002799mg [Prunus persica] gi|462404082|gb|EMJ09639.1| hypothetical protein PRUPE_ppa002799mg [Prunus persica] Length = 632 Score = 78.6 bits (192), Expect = 8e-13 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +2 Query: 266 MEKVSTDCPYPGCFFCVMKEGNPSKRRACILKFFREL 376 M+KVS+DCPYPGCFFCVMKEGNPSKRRA ILKFFREL Sbjct: 9 MDKVSSDCPYPGCFFCVMKEGNPSKRRASILKFFREL 45 >ref|XP_007159648.1| hypothetical protein PHAVU_002G255400g [Phaseolus vulgaris] gi|561033063|gb|ESW31642.1| hypothetical protein PHAVU_002G255400g [Phaseolus vulgaris] Length = 626 Score = 78.2 bits (191), Expect = 1e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +2 Query: 266 MEKVSTDCPYPGCFFCVMKEGNPSKRRACILKFFREL 376 M+KVS+DCPYPGCFFCVMKEGNPSKRRA +LKFFREL Sbjct: 1 MDKVSSDCPYPGCFFCVMKEGNPSKRRASVLKFFREL 37 >ref|XP_003531355.1| PREDICTED: uncharacterized protein LOC100816695 [Glycine max] Length = 627 Score = 78.2 bits (191), Expect = 1e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +2 Query: 266 MEKVSTDCPYPGCFFCVMKEGNPSKRRACILKFFREL 376 M+KVS+DCPYPGCFFCVMKEGNPSKRRA +LKFFREL Sbjct: 1 MDKVSSDCPYPGCFFCVMKEGNPSKRRASVLKFFREL 37 >ref|XP_003524266.1| PREDICTED: uncharacterized protein LOC100800996 [Glycine max] Length = 627 Score = 78.2 bits (191), Expect = 1e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +2 Query: 266 MEKVSTDCPYPGCFFCVMKEGNPSKRRACILKFFREL 376 M+KVS+DCPYPGCFFCVMKEGNPSKRRA +LKFFREL Sbjct: 1 MDKVSSDCPYPGCFFCVMKEGNPSKRRASVLKFFREL 37 >ref|XP_006380423.1| hypothetical protein POPTR_0007s05550g [Populus trichocarpa] gi|550334192|gb|ERP58220.1| hypothetical protein POPTR_0007s05550g [Populus trichocarpa] Length = 630 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 266 MEKVSTDCPYPGCFFCVMKEGNPSKRRACILKFFREL 376 M+KVS DCPYPGCFFCVMKEGNPSKRRA ILKFFREL Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSKRRASILKFFREL 37 >ref|XP_002533208.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] gi|223526984|gb|EEF29179.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] Length = 627 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 266 MEKVSTDCPYPGCFFCVMKEGNPSKRRACILKFFREL 376 M+KVS DCPYPGCFFCVMKEGNPSKRRA ILKFFREL Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSKRRASILKFFREL 37 >ref|XP_002307091.1| hypothetical protein POPTR_0005s07790g [Populus trichocarpa] gi|222856540|gb|EEE94087.1| hypothetical protein POPTR_0005s07790g [Populus trichocarpa] Length = 618 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 266 MEKVSTDCPYPGCFFCVMKEGNPSKRRACILKFFREL 376 M+KVS DCPYPGCFFCVMKEGNPSKRRA ILKFFREL Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSKRRASILKFFREL 37 >emb|CAN77716.1| hypothetical protein VITISV_023407 [Vitis vinifera] Length = 635 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 266 MEKVSTDCPYPGCFFCVMKEGNPSKRRACILKFFREL 376 M+KVS DCPYPGCFFCVMKEGNPSKRRA ILKFFREL Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSKRRASILKFFREL 37 >ref|XP_006355353.1| PREDICTED: uncharacterized protein LOC102588167 [Solanum tuberosum] Length = 629 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = +2 Query: 266 MEKVSTDCPYPGCFFCVMKEGNPSKRRACILKFFREL 376 M+K S DCPYPGCFFCVMKEGNPSKRRA ILKFFREL Sbjct: 3 MDKASADCPYPGCFFCVMKEGNPSKRRASILKFFREL 39 >ref|XP_007047977.1| ARM-repeat/Tetratricopeptide repeat (TPR)-like protein isoform 2 [Theobroma cacao] gi|508700238|gb|EOX92134.1| ARM-repeat/Tetratricopeptide repeat (TPR)-like protein isoform 2 [Theobroma cacao] Length = 621 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 266 MEKVSTDCPYPGCFFCVMKEGNPSKRRACILKFFREL 376 M+KVS DCPYPGCFFCVMKEGNPSKRRA ILKFFR+L Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSKRRASILKFFRDL 37 >ref|XP_007047976.1| ARM-repeat/Tetratricopeptide repeat (TPR)-like protein isoform 1 [Theobroma cacao] gi|508700237|gb|EOX92133.1| ARM-repeat/Tetratricopeptide repeat (TPR)-like protein isoform 1 [Theobroma cacao] Length = 630 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 266 MEKVSTDCPYPGCFFCVMKEGNPSKRRACILKFFREL 376 M+KVS DCPYPGCFFCVMKEGNPSKRRA ILKFFR+L Sbjct: 1 MDKVSPDCPYPGCFFCVMKEGNPSKRRASILKFFRDL 37 >ref|XP_004237397.1| PREDICTED: uncharacterized protein LOC101261016 [Solanum lycopersicum] Length = 629 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = +2 Query: 266 MEKVSTDCPYPGCFFCVMKEGNPSKRRACILKFFREL 376 M+K S DCPYPGCFFCVMKEGNPSKRRA ILKFFREL Sbjct: 3 MDKASADCPYPGCFFCVMKEGNPSKRRASILKFFREL 39 >gb|EXB29432.1| hypothetical protein L484_022103 [Morus notabilis] Length = 786 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 266 MEKVSTDCPYPGCFFCVMKEGNPSKRRACILKFFREL 376 M+KVS+DC YPGCFFCVMKEGNPSKRRA ILKFFREL Sbjct: 1 MDKVSSDCQYPGCFFCVMKEGNPSKRRASILKFFREL 37 >ref|XP_006826923.1| hypothetical protein AMTR_s00010p00170700 [Amborella trichopoda] gi|548831352|gb|ERM94160.1| hypothetical protein AMTR_s00010p00170700 [Amborella trichopoda] Length = 627 Score = 75.5 bits (184), Expect = 7e-12 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +2 Query: 266 MEKVSTDCPYPGCFFCVMKEGNPSKRRACILKFFREL 376 M+K+S DCPYPGCFFCVMKEGNP+KRRA I+KFFREL Sbjct: 1 MDKISQDCPYPGCFFCVMKEGNPNKRRASIMKFFREL 37 >ref|NP_001055582.1| Os05g0421300 [Oryza sativa Japonica Group] gi|48475180|gb|AAT44249.1| putative tetratricopeptide repeat (TPR)-containing protein [Oryza sativa Japonica Group] gi|113579133|dbj|BAF17496.1| Os05g0421300 [Oryza sativa Japonica Group] gi|215737118|dbj|BAG96047.1| unnamed protein product [Oryza sativa Japonica Group] gi|218196823|gb|EEC79250.1| hypothetical protein OsI_20013 [Oryza sativa Indica Group] gi|222631637|gb|EEE63769.1| hypothetical protein OsJ_18590 [Oryza sativa Japonica Group] Length = 601 Score = 75.1 bits (183), Expect = 9e-12 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 266 MEKVSTDCPYPGCFFCVMKEGNPSKRRACILKFFREL 376 MEK+ +DCPYPGCFFCVMKE NPSKRRA +LKFFREL Sbjct: 1 MEKIQSDCPYPGCFFCVMKEANPSKRRASVLKFFREL 37 >ref|XP_004504067.1| PREDICTED: uncharacterized protein LOC101505144 [Cicer arietinum] Length = 606 Score = 74.7 bits (182), Expect = 1e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +2 Query: 266 MEKVSTDCPYPGCFFCVMKEGNPSKRRACILKFFREL 376 M+KVS+DCPYPGCFFCVMKE NPSKRR+ +LKFFREL Sbjct: 1 MDKVSSDCPYPGCFFCVMKEANPSKRRSSVLKFFREL 37 >ref|XP_006647288.1| PREDICTED: uncharacterized protein LOC102715088 isoform X1 [Oryza brachyantha] gi|573919349|ref|XP_006647289.1| PREDICTED: uncharacterized protein LOC102715088 isoform X2 [Oryza brachyantha] Length = 609 Score = 74.3 bits (181), Expect = 2e-11 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 263 IMEKVSTDCPYPGCFFCVMKEGNPSKRRACILKFFREL 376 +MEK +DCPYPGCFFCVMKE NPSKRRA +LKFFREL Sbjct: 1 MMEKAQSDCPYPGCFFCVMKEANPSKRRASVLKFFREL 38 >ref|XP_004300163.1| PREDICTED: uncharacterized protein LOC101308873 [Fragaria vesca subsp. vesca] Length = 631 Score = 74.3 bits (181), Expect = 2e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +2 Query: 266 MEKVSTDCPYPGCFFCVMKEGNPSKRRACILKFFREL 376 M+K S++CPYPGCFFCVMKEGNPSKRRA ILKFFR+L Sbjct: 1 MDKASSECPYPGCFFCVMKEGNPSKRRASILKFFRDL 37