BLASTX nr result
ID: Paeonia24_contig00037402
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00037402 (304 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002305066.2| hypothetical protein POPTR_0004s05660g [Popu... 66 6e-09 ref|XP_002533964.1| conserved hypothetical protein [Ricinus comm... 62 1e-07 emb|CBI30694.3| unnamed protein product [Vitis vinifera] 61 1e-07 emb|CAN60072.1| hypothetical protein VITISV_022946 [Vitis vinifera] 61 1e-07 ref|XP_007159455.1| hypothetical protein PHAVU_002G239100g [Phas... 59 5e-07 ref|XP_007025361.1| Myb-like HTH transcriptional regulator famil... 57 3e-06 ref|XP_003524206.1| PREDICTED: two-component response regulator ... 57 3e-06 ref|XP_003629774.1| Myb family transcription factor APL [Medicag... 55 8e-06 >ref|XP_002305066.2| hypothetical protein POPTR_0004s05660g [Populus trichocarpa] gi|550340400|gb|EEE85577.2| hypothetical protein POPTR_0004s05660g [Populus trichocarpa] Length = 309 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/60 (53%), Positives = 40/60 (66%) Frame = +1 Query: 10 SQFESEYQSPFRLTLNLEKKLKDKEWFPDLQLSPSQSAGNKNEKIHDNSRNEINTMLSLS 189 + F+ E+ PFR+ LN +K LKDKEW PDLQL +Q G K+ K H S EI+T LSLS Sbjct: 250 NSFKPEFDPPFRVELNHDKLLKDKEWLPDLQLRMNQRVGIKDRKTHCRSTQEISTKLSLS 309 >ref|XP_002533964.1| conserved hypothetical protein [Ricinus communis] gi|223526061|gb|EEF28420.1| conserved hypothetical protein [Ricinus communis] Length = 149 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/58 (51%), Positives = 38/58 (65%) Frame = +1 Query: 16 FESEYQSPFRLTLNLEKKLKDKEWFPDLQLSPSQSAGNKNEKIHDNSRNEINTMLSLS 189 F++ ++ PFRL +N +K LK+KEW PDLQL SQ G K H S EI+T LSLS Sbjct: 92 FKAAFEPPFRLEVNKDKLLKEKEWLPDLQLRLSQRVGMDENKSHCRSTQEISTKLSLS 149 >emb|CBI30694.3| unnamed protein product [Vitis vinifera] Length = 428 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/62 (51%), Positives = 42/62 (67%) Frame = +1 Query: 4 VSSQFESEYQSPFRLTLNLEKKLKDKEWFPDLQLSPSQSAGNKNEKIHDNSRNEINTMLS 183 +SS + + PFRL N EK+LK++EW PDLQL SQ + N+ E H S+ E+NTMLS Sbjct: 330 ISSISTPQIEPPFRLESNQEKRLKEEEWLPDLQLRLSQRSANE-EDTHHKSKYEMNTMLS 388 Query: 184 LS 189 LS Sbjct: 389 LS 390 >emb|CAN60072.1| hypothetical protein VITISV_022946 [Vitis vinifera] Length = 333 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/62 (51%), Positives = 42/62 (67%) Frame = +1 Query: 4 VSSQFESEYQSPFRLTLNLEKKLKDKEWFPDLQLSPSQSAGNKNEKIHDNSRNEINTMLS 183 +SS + + PFRL N EK+LK++EW PDLQL SQ + N+ E H S+ E+NTMLS Sbjct: 235 ISSISTPQIEPPFRLESNQEKRLKEEEWLPDLQLRLSQRSANE-EDTHHKSKYEMNTMLS 293 Query: 184 LS 189 LS Sbjct: 294 LS 295 >ref|XP_007159455.1| hypothetical protein PHAVU_002G239100g [Phaseolus vulgaris] gi|593792834|ref|XP_007159456.1| hypothetical protein PHAVU_002G239100g [Phaseolus vulgaris] gi|561032870|gb|ESW31449.1| hypothetical protein PHAVU_002G239100g [Phaseolus vulgaris] gi|561032871|gb|ESW31450.1| hypothetical protein PHAVU_002G239100g [Phaseolus vulgaris] Length = 390 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/62 (50%), Positives = 40/62 (64%), Gaps = 1/62 (1%) Frame = +1 Query: 7 SSQFESEYQSPFRLTLNLEKKLKDKEWFPDLQLSPSQSAGNKNEKI-HDNSRNEINTMLS 183 S+ + E++ PFR+ N EK K+K+W PDL+LS SQ GN +EK H EINT LS Sbjct: 329 SNSSKLEFEPPFRIKSNQEKMQKEKQWMPDLRLSLSQRDGNNDEKTDHCRETQEINTKLS 388 Query: 184 LS 189 LS Sbjct: 389 LS 390 >ref|XP_007025361.1| Myb-like HTH transcriptional regulator family protein, putative [Theobroma cacao] gi|508780727|gb|EOY27983.1| Myb-like HTH transcriptional regulator family protein, putative [Theobroma cacao] Length = 406 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/60 (48%), Positives = 36/60 (60%) Frame = +1 Query: 10 SQFESEYQSPFRLTLNLEKKLKDKEWFPDLQLSPSQSAGNKNEKIHDNSRNEINTMLSLS 189 S E+++P L L +K LKD+EW PDLQL SQ G +EK H EI+T LSLS Sbjct: 347 SSCRPEFEAPLWLELKQDKLLKDREWLPDLQLRLSQRIGIDDEKTHCKGTEEISTQLSLS 406 >ref|XP_003524206.1| PREDICTED: two-component response regulator ARR14-like [Glycine max] Length = 401 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/62 (48%), Positives = 39/62 (62%), Gaps = 1/62 (1%) Frame = +1 Query: 7 SSQFESEYQSPFRLTLNLEKKLKDKEWFPDLQLSPSQSAGNKNEKI-HDNSRNEINTMLS 183 S+ F+ E++ PFR+ N EK K+ +W PDL+LS SQ GN + K H EINT LS Sbjct: 340 SNSFKLEFEPPFRIKSNQEKLQKENQWAPDLRLSLSQRDGNNDGKTDHCRETQEINTKLS 399 Query: 184 LS 189 LS Sbjct: 400 LS 401 >ref|XP_003629774.1| Myb family transcription factor APL [Medicago truncatula] gi|355523796|gb|AET04250.1| Myb family transcription factor APL [Medicago truncatula] Length = 426 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/56 (53%), Positives = 36/56 (64%), Gaps = 1/56 (1%) Frame = +1 Query: 25 EYQSPFRLTLNLEKKLKDKEWFPDLQLSPSQSAGNKNEKIHD-NSRNEINTMLSLS 189 E+ PFR+ LN E LKDK+W PDLQLS SQ+ GN + K EI+T LSLS Sbjct: 371 EFDPPFRIKLNQETLLKDKQWVPDLQLSLSQTNGNNDGKSDGLRETKEIDTKLSLS 426