BLASTX nr result
ID: Paeonia24_contig00036966
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00036966 (574 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71467.1| hypothetical protein VITISV_038988 [Vitis vinifera] 128 9e-28 ref|XP_002517741.1| conserved hypothetical protein [Ricinus comm... 70 3e-13 ref|XP_002518274.1| conserved hypothetical protein [Ricinus comm... 64 4e-12 ref|XP_007155714.1| hypothetical protein PHAVU_003G225200g [Phas... 67 3e-09 >emb|CAN71467.1| hypothetical protein VITISV_038988 [Vitis vinifera] Length = 280 Score = 128 bits (322), Expect = 9e-28 Identities = 61/73 (83%), Positives = 66/73 (90%) Frame = -2 Query: 219 GIILNGFSSCLF*QLILRSPRQELPGDDRGTNPPAVAGRLFCFTIRPGRLSLPSVAYEFT 40 G++ ++C QLILRSPRQELPGDDRGTNPPAVAGRLFCFTIRPGRLSLPSVAYEFT Sbjct: 122 GLVGKRSAACRAHQLILRSPRQELPGDDRGTNPPAVAGRLFCFTIRPGRLSLPSVAYEFT 181 Query: 39 SIPGRIQFPFDFS 1 SIPGR+QFPFDFS Sbjct: 182 SIPGRVQFPFDFS 194 >ref|XP_002517741.1| conserved hypothetical protein [Ricinus communis] gi|223543139|gb|EEF44673.1| conserved hypothetical protein [Ricinus communis] Length = 111 Score = 70.1 bits (170), Expect(2) = 3e-13 Identities = 48/77 (62%), Positives = 51/77 (66%), Gaps = 6/77 (7%) Frame = +1 Query: 97 KKPPRHSWRVGSSVVAGELLARRP*DKLLKQTG--GKTVQYNSEERLLAAGGLLSLQKEK 270 K P HS RVGSS+VAG+LL RRP LKQ G + VQ N EERLLA GG LSL K Sbjct: 37 KIAPHHSRRVGSSIVAGQLLVRRP--YFLKQKGEEDRPVQSNFEERLLAVGGDLSLALFK 94 Query: 271 R----AG*SSAEGSRIG 309 R AG SSAEGSRIG Sbjct: 95 RKCRGAGLSSAEGSRIG 111 Score = 30.8 bits (68), Expect(2) = 3e-13 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +2 Query: 2 EKSKGNCIRPGMD 40 EKSKGNC RPGMD Sbjct: 24 EKSKGNCTRPGMD 36 >ref|XP_002518274.1| conserved hypothetical protein [Ricinus communis] gi|223542494|gb|EEF44034.1| conserved hypothetical protein [Ricinus communis] Length = 431 Score = 64.3 bits (155), Expect(2) = 4e-12 Identities = 33/57 (57%), Positives = 38/57 (66%) Frame = -2 Query: 171 LRSPRQELPGDDRGTNPPAVAGRLFCFTIRPGRLSLPSVAYEFTSIPGRIQFPFDFS 1 LR PR+ + P G LF FTIRPGRLSLPSVA +F S+P R+QFPFDFS Sbjct: 63 LRVPRRR-----QKNQPVCCGGALFFFTIRPGRLSLPSVACKFMSVPSRVQFPFDFS 114 Score = 32.7 bits (73), Expect(2) = 4e-12 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = -3 Query: 326 LRTGPYPILEPSAELYPARFSF*RLKRP 243 + GPYPILEPSA L PA F LKRP Sbjct: 1 MHKGPYPILEPSAGLNPAPPHF-LLKRP 27 >ref|XP_007155714.1| hypothetical protein PHAVU_003G225200g [Phaseolus vulgaris] gi|561029068|gb|ESW27708.1| hypothetical protein PHAVU_003G225200g [Phaseolus vulgaris] Length = 73 Score = 67.4 bits (163), Expect = 3e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 94 FHNKTWTIIPTLGSLRVYVHPWSDTVSFRFL 2 FHNKTWTIIPTLGSLR+YVHPW DTVSFRF+ Sbjct: 7 FHNKTWTIIPTLGSLRLYVHPWLDTVSFRFI 37