BLASTX nr result
ID: Paeonia24_contig00036961
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00036961 (289 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB36954.1| hypothetical protein L484_018330 [Morus notabilis] 58 2e-06 >gb|EXB36954.1| hypothetical protein L484_018330 [Morus notabilis] Length = 217 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = +2 Query: 8 KNSASKSYMELPPHMATPGMEVGPTQVCAITVIIHGL 118 K SASK Y+ELPPH A GMEVGPTQ CA+ V++H L Sbjct: 60 KGSASKPYVELPPHTAPLGMEVGPTQACAVKVVVHDL 96