BLASTX nr result
ID: Paeonia24_contig00036670
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00036670 (269 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN63378.1| hypothetical protein VITISV_015700 [Vitis vinifera] 61 2e-07 ref|XP_004509401.1| PREDICTED: aspartic proteinase-like protein ... 60 2e-07 ref|XP_003629249.1| Aspartic proteinase-like protein [Medicago t... 60 2e-07 ref|XP_006574660.1| PREDICTED: aspartic proteinase-like protein ... 60 3e-07 ref|XP_002269880.1| PREDICTED: aspartic proteinase-like protein ... 59 7e-07 ref|XP_002534040.1| Aspartic proteinase nepenthesin-2 precursor,... 59 7e-07 gb|EXC35304.1| Aspartic proteinase-like protein 1 [Morus notabilis] 56 6e-06 gb|EXC35303.1| Aspartic proteinase-like protein 1 [Morus notabilis] 56 6e-06 >emb|CAN63378.1| hypothetical protein VITISV_015700 [Vitis vinifera] Length = 585 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 107 DFELSIYNPKG*STSKKVTYNINLCTHWNRCLGTF 3 DFELSIYNPKG STS+KVT N +LC H NRCLGTF Sbjct: 147 DFELSIYNPKGSSTSRKVTCNNSLCAHRNRCLGTF 181 >ref|XP_004509401.1| PREDICTED: aspartic proteinase-like protein 1-like [Cicer arietinum] Length = 523 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -1 Query: 116 LCQDFELSIYNPKG*STSKKVTYNINLCTHWNRCLGTF 3 L DF+LS+YNP G STSKKVT N +LCTH N+CLGTF Sbjct: 143 LASDFDLSVYNPNGSSTSKKVTCNNSLCTHRNQCLGTF 180 >ref|XP_003629249.1| Aspartic proteinase-like protein [Medicago truncatula] gi|355523271|gb|AET03725.1| Aspartic proteinase-like protein [Medicago truncatula] Length = 553 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -1 Query: 116 LCQDFELSIYNPKG*STSKKVTYNINLCTHWNRCLGTF 3 L DF+LS+YNP G STSKKVT N +LCTH N+CLGTF Sbjct: 146 LASDFDLSVYNPNGSSTSKKVTCNNSLCTHRNQCLGTF 183 >ref|XP_006574660.1| PREDICTED: aspartic proteinase-like protein 1-like [Glycine max] Length = 524 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = -1 Query: 122 ALLCQDFELSIYNPKG*STSKKVTYNINLCTHWNRCLGTF 3 AL QDF+L++YNP G STSKKVT N +LCTH ++CLGTF Sbjct: 144 ALATQDFDLNVYNPNGSSTSKKVTCNNSLCTHRSQCLGTF 183 >ref|XP_002269880.1| PREDICTED: aspartic proteinase-like protein 1 [Vitis vinifera] gi|297739017|emb|CBI28369.3| unnamed protein product [Vitis vinifera] Length = 518 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 107 DFELSIYNPKG*STSKKVTYNINLCTHWNRCLGTF 3 DFELSIYNPKG STS+KVT + +LC H NRCLGTF Sbjct: 147 DFELSIYNPKGSSTSRKVTCDNSLCAHRNRCLGTF 181 >ref|XP_002534040.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus communis] gi|223525947|gb|EEF28344.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus communis] Length = 518 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = -1 Query: 107 DFELSIYNPKG*STSKKVTYNINLCTHWNRCLGTF 3 DFELSIY+PK STSKKVT N NLC H NRCLGTF Sbjct: 145 DFELSIYDPKQSSTSKKVTCNNNLCAHRNRCLGTF 179 >gb|EXC35304.1| Aspartic proteinase-like protein 1 [Morus notabilis] Length = 940 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -1 Query: 107 DFELSIYNPKG*STSKKVTYNINLCTHWNRCLGTF 3 DF+LS+Y+PKG STSKKVT N +LC H +RCLGTF Sbjct: 113 DFQLSMYDPKGSSTSKKVTCNDSLCVHRSRCLGTF 147 >gb|EXC35303.1| Aspartic proteinase-like protein 1 [Morus notabilis] Length = 497 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -1 Query: 107 DFELSIYNPKG*STSKKVTYNINLCTHWNRCLGTF 3 DF+LS+Y+PKG STSKKVT N +LC H +RCLGTF Sbjct: 156 DFQLSMYDPKGSSTSKKVTCNDSLCVHRSRCLGTF 190