BLASTX nr result
ID: Paeonia24_contig00036629
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00036629 (290 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522430.1| pentatricopeptide repeat-containing protein,... 68 1e-09 gb|EXC35441.1| hypothetical protein L484_026747 [Morus notabilis] 59 5e-07 ref|XP_004289123.1| PREDICTED: putative pentatricopeptide repeat... 55 8e-06 >ref|XP_002522430.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223538315|gb|EEF39922.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 556 Score = 68.2 bits (165), Expect = 1e-09 Identities = 37/75 (49%), Positives = 51/75 (68%), Gaps = 6/75 (8%) Frame = +3 Query: 84 MILLVRPHIRRLCTSST---IEYRGLLVSN---DQLAHKANAFTQVDMFEANSELKQLVK 245 M + VRP+IRRLC +S+ +YR L V+ + L+HK ++M E NS+LK LVK Sbjct: 1 MAVAVRPYIRRLCAASSSTCTDYRDLSVAYSVPNNLSHKTQPSNLINMLEINSKLKALVK 60 Query: 246 TGSLRDARQLFDKMP 290 TG L+DARQ+FD+MP Sbjct: 61 TGCLQDARQMFDEMP 75 >gb|EXC35441.1| hypothetical protein L484_026747 [Morus notabilis] Length = 711 Score = 59.3 bits (142), Expect = 5e-07 Identities = 35/75 (46%), Positives = 45/75 (60%), Gaps = 6/75 (8%) Frame = +3 Query: 84 MILLVRPHIRRLCTS---STIEYRGLLVSN---DQLAHKANAFTQVDMFEANSELKQLVK 245 + L VRP IRR+ T+ S+ E+ L S DQ + + V+M E NS LK+LVK Sbjct: 2 VFLSVRPRIRRIFTAQAFSSTEHENFLTSAGGPDQSFEETHVVNHVEMHELNSRLKELVK 61 Query: 246 TGSLRDARQLFDKMP 290 TG L DAR LFD+MP Sbjct: 62 TGHLNDARNLFDEMP 76 >ref|XP_004289123.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g47840-like [Fragaria vesca subsp. vesca] Length = 696 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/76 (42%), Positives = 47/76 (61%), Gaps = 7/76 (9%) Frame = +3 Query: 84 MILLVRPHIRRLCTSSTIEY---RGLLVS----NDQLAHKANAFTQVDMFEANSELKQLV 242 M+ +R RRL TSS + + R L+++ +Q HK + VD+ E NS+LKQLV Sbjct: 1 MVRTIRSQFRRLFTSSPLAHPQCRSLVLAPESKTEQRDHKTHHANHVDIPELNSQLKQLV 60 Query: 243 KTGSLRDARQLFDKMP 290 K G L+ AR++FD+MP Sbjct: 61 KAGDLKHARKVFDEMP 76