BLASTX nr result
ID: Paeonia24_contig00036593
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00036593 (689 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007198902.1| hypothetical protein PRUPE_ppa005316mg [Prun... 74 3e-11 gb|EXB79632.1| hypothetical protein L484_011572 [Morus notabilis] 72 2e-10 gb|EXC03817.1| hypothetical protein L484_012430 [Morus notabilis] 69 1e-09 emb|CBI21840.3| unnamed protein product [Vitis vinifera] 69 1e-09 ref|XP_002273904.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 ref|XP_004155523.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 ref|XP_004136821.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 emb|CAN73453.1| hypothetical protein VITISV_024964 [Vitis vinifera] 66 9e-09 ref|XP_002262853.2| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 ref|XP_007200782.1| hypothetical protein PRUPE_ppa024012mg [Prun... 65 3e-08 ref|XP_007029136.1| Tetratricopeptide repeat-like superfamily pr... 64 6e-08 gb|AFK47046.1| unknown [Lotus japonicus] 63 8e-08 ref|XP_004303401.1| PREDICTED: pentatricopeptide repeat-containi... 63 1e-07 ref|XP_007199471.1| hypothetical protein PRUPE_ppa027115mg [Prun... 63 1e-07 ref|XP_002517927.1| pentatricopeptide repeat-containing protein,... 63 1e-07 ref|XP_002531595.1| pentatricopeptide repeat-containing protein,... 62 1e-07 ref|XP_006376506.1| pentatricopeptide repeat-containing family p... 62 2e-07 ref|XP_006377348.1| hypothetical protein POPTR_0011s05140g [Popu... 61 4e-07 ref|XP_002517926.1| pentatricopeptide repeat-containing protein,... 60 7e-07 ref|XP_004487291.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 >ref|XP_007198902.1| hypothetical protein PRUPE_ppa005316mg [Prunus persica] gi|462394197|gb|EMJ00101.1| hypothetical protein PRUPE_ppa005316mg [Prunus persica] Length = 467 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/64 (51%), Positives = 46/64 (71%) Frame = -3 Query: 687 AVEMMKKAIQVLRPGWKLNRDTFAACLDFLKGKGDVEVAEEFIKLLKEQDHLEKNTCNKL 508 AVE MK+AI +PGW+LN AACL++LK KG++EVA E + L++E+DH + C+KL Sbjct: 403 AVETMKRAILASQPGWELNHLILAACLEYLKEKGNLEVAHELLSLIRERDHFSEELCDKL 462 Query: 507 VNYI 496 YI Sbjct: 463 EKYI 466 >gb|EXB79632.1| hypothetical protein L484_011572 [Morus notabilis] Length = 418 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/65 (52%), Positives = 46/65 (70%) Frame = -3 Query: 687 AVEMMKKAIQVLRPGWKLNRDTFAACLDFLKGKGDVEVAEEFIKLLKEQDHLEKNTCNKL 508 AVE MKKA+ P KLNR T A CL++LK +GDVE A E + LL+EQ+ L + C++L Sbjct: 322 AVETMKKAVLANEPKLKLNRSTLAVCLEYLKREGDVETAHEILGLLREQNSLSNDICDRL 381 Query: 507 VNYIH 493 VN+I+ Sbjct: 382 VNFIN 386 >gb|EXC03817.1| hypothetical protein L484_012430 [Morus notabilis] Length = 519 Score = 69.3 bits (168), Expect = 1e-09 Identities = 33/66 (50%), Positives = 46/66 (69%) Frame = -3 Query: 687 AVEMMKKAIQVLRPGWKLNRDTFAACLDFLKGKGDVEVAEEFIKLLKEQDHLEKNTCNKL 508 AVE +K+ I V P WKL++D A CLD+L GKGDVE AEE I+LLK++D + + +L Sbjct: 414 AVESIKEEISVAEPWWKLSKDNVAVCLDYLIGKGDVEQAEEIIRLLKDKDFVSMDGHERL 473 Query: 507 VNYIHD 490 +N I + Sbjct: 474 LNKIKE 479 >emb|CBI21840.3| unnamed protein product [Vitis vinifera] Length = 446 Score = 68.9 bits (167), Expect = 1e-09 Identities = 36/75 (48%), Positives = 49/75 (65%), Gaps = 3/75 (4%) Frame = -3 Query: 687 AVEMMKKAIQVLRPGWKLNRDTFAACLDFLKGKGDVEVAEEFIKLLKEQDHLEKNTCNKL 508 AV+ +KKA+ GWK N T +ACL++LKGKGDVE AE I+LL+EQ + ++L Sbjct: 347 AVDTLKKALLATSQGWKPNPVTLSACLEYLKGKGDVEEAENLIRLLREQSLVSAYDSDRL 406 Query: 507 VNYIHD---GTGSIA 472 VNYI G+ +IA Sbjct: 407 VNYIRSEEPGSSTIA 421 >ref|XP_002273904.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial [Vitis vinifera] Length = 499 Score = 68.9 bits (167), Expect = 1e-09 Identities = 36/75 (48%), Positives = 49/75 (65%), Gaps = 3/75 (4%) Frame = -3 Query: 687 AVEMMKKAIQVLRPGWKLNRDTFAACLDFLKGKGDVEVAEEFIKLLKEQDHLEKNTCNKL 508 AV+ +KKA+ GWK N T +ACL++LKGKGDVE AE I+LL+EQ + ++L Sbjct: 400 AVDTLKKALLATSQGWKPNPVTLSACLEYLKGKGDVEEAENLIRLLREQSLVSAYDSDRL 459 Query: 507 VNYIHD---GTGSIA 472 VNYI G+ +IA Sbjct: 460 VNYIRSEEPGSSTIA 474 >ref|XP_004155523.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 201 Score = 68.6 bits (166), Expect = 2e-09 Identities = 34/65 (52%), Positives = 43/65 (66%) Frame = -3 Query: 687 AVEMMKKAIQVLRPGWKLNRDTFAACLDFLKGKGDVEVAEEFIKLLKEQDHLEKNTCNKL 508 A E +KKAI V P WK N D AACL++LK G+VE+AEE I LL ++D N C +L Sbjct: 117 AAETLKKAISVSPPRWKPNYDILAACLEYLKTNGNVELAEEIIGLLCKRDIFPLNICKRL 176 Query: 507 VNYIH 493 +YIH Sbjct: 177 EDYIH 181 >ref|XP_004136821.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 486 Score = 68.6 bits (166), Expect = 2e-09 Identities = 34/65 (52%), Positives = 43/65 (66%) Frame = -3 Query: 687 AVEMMKKAIQVLRPGWKLNRDTFAACLDFLKGKGDVEVAEEFIKLLKEQDHLEKNTCNKL 508 A E +KKAI V P WK N D AACL++LK G+VE+AEE I LL ++D N C +L Sbjct: 402 AAETLKKAISVSPPRWKPNYDILAACLEYLKTNGNVELAEEIIGLLCKRDIFPLNICKRL 461 Query: 507 VNYIH 493 +YIH Sbjct: 462 EDYIH 466 >emb|CAN73453.1| hypothetical protein VITISV_024964 [Vitis vinifera] Length = 499 Score = 66.2 bits (160), Expect = 9e-09 Identities = 35/75 (46%), Positives = 48/75 (64%), Gaps = 3/75 (4%) Frame = -3 Query: 687 AVEMMKKAIQVLRPGWKLNRDTFAACLDFLKGKGDVEVAEEFIKLLKEQDHLEKNTCNKL 508 AV+ +KKA+ GWK N T +ACL++LKGK DVE AE I+LL+EQ + ++L Sbjct: 400 AVDTLKKALLATSQGWKPNPVTLSACLEYLKGKXDVEEAENLIRLLREQSLVSAYDSDRL 459 Query: 507 VNYIHD---GTGSIA 472 VNYI G+ +IA Sbjct: 460 VNYIRSEEPGSSTIA 474 >ref|XP_002262853.2| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Vitis vinifera] Length = 494 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/67 (43%), Positives = 44/67 (65%) Frame = -3 Query: 687 AVEMMKKAIQVLRPGWKLNRDTFAACLDFLKGKGDVEVAEEFIKLLKEQDHLEKNTCNKL 508 AVE +KKA+ V P WK +++T A CL++L+G DVE A EFI+ L+ + C +L Sbjct: 414 AVEALKKAVVVCPPNWKPSKNTLATCLEYLEGNRDVEGAGEFIRFLQNEGIFSVGVCKRL 473 Query: 507 VNYIHDG 487 ++YI +G Sbjct: 474 LSYIENG 480 >ref|XP_007200782.1| hypothetical protein PRUPE_ppa024012mg [Prunus persica] gi|462396182|gb|EMJ01981.1| hypothetical protein PRUPE_ppa024012mg [Prunus persica] Length = 480 Score = 64.7 bits (156), Expect = 3e-08 Identities = 31/65 (47%), Positives = 41/65 (63%), Gaps = 1/65 (1%) Frame = -3 Query: 687 AVEMMKKAIQ-VLRPGWKLNRDTFAACLDFLKGKGDVEVAEEFIKLLKEQDHLEKNTCNK 511 AVE +K A RPGWK + T AAC ++LK KGDVE A E + L +E+ H + C+K Sbjct: 405 AVETLKMAASSASRPGWKFDNSTLAACFEYLKQKGDVEKAHELLILFRERGHFTTDLCDK 464 Query: 510 LVNYI 496 + NYI Sbjct: 465 IRNYI 469 >ref|XP_007029136.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508717741|gb|EOY09638.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] Length = 496 Score = 63.5 bits (153), Expect = 6e-08 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 4/79 (5%) Frame = -3 Query: 687 AVEMMKKAIQVLRPGWKLN----RDTFAACLDFLKGKGDVEVAEEFIKLLKEQDHLEKNT 520 AVE MK+AI ++ P WK ++ AACL +LKGKGD++ A+ FIKLL ++D + Sbjct: 378 AVEAMKEAILIIEPCWKPRLKPREESVAACLKYLKGKGDMDEAKIFIKLLGDRDIISPEV 437 Query: 519 CNKLVNYIHDGTGSIASNG 463 KL++YI DG +G Sbjct: 438 QVKLLSYIKDGNADSKLDG 456 >gb|AFK47046.1| unknown [Lotus japonicus] Length = 496 Score = 63.2 bits (152), Expect = 8e-08 Identities = 31/65 (47%), Positives = 42/65 (64%) Frame = -3 Query: 687 AVEMMKKAIQVLRPGWKLNRDTFAACLDFLKGKGDVEVAEEFIKLLKEQDHLEKNTCNKL 508 AV+ MKKAI RPGW+ + T AC+ +LK K D+E A E +KL KE H++ T + L Sbjct: 399 AVQTMKKAILANRPGWRPSPSTLVACITYLKEKLDLESALEILKLCKEDGHIKITTYDGL 458 Query: 507 VNYIH 493 V+Y H Sbjct: 459 VSYAH 463 >ref|XP_004303401.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 506 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/70 (40%), Positives = 45/70 (64%) Frame = -3 Query: 687 AVEMMKKAIQVLRPGWKLNRDTFAACLDFLKGKGDVEVAEEFIKLLKEQDHLEKNTCNKL 508 AVE KA+ +PGW N+D CL++ K K D+E AE+FIKLL++++ + N +L Sbjct: 408 AVESATKAVSSAQPGWMPNKDVVVGCLEYFKMKADLEGAEKFIKLLRDKNIIRVNMQERL 467 Query: 507 VNYIHDGTGS 478 +N+I +G + Sbjct: 468 LNHIKNGNST 477 >ref|XP_007199471.1| hypothetical protein PRUPE_ppa027115mg [Prunus persica] gi|462394871|gb|EMJ00670.1| hypothetical protein PRUPE_ppa027115mg [Prunus persica] Length = 350 Score = 62.8 bits (151), Expect = 1e-07 Identities = 31/68 (45%), Positives = 45/68 (66%), Gaps = 1/68 (1%) Frame = -3 Query: 687 AVEMMKKAIQVL-RPGWKLNRDTFAACLDFLKGKGDVEVAEEFIKLLKEQDHLEKNTCNK 511 AVE MK A ++ RPG K N T ACL +LK KGD++ A E ++LL+++ +L +C+K Sbjct: 279 AVEAMKNAAKMSSRPGRKFNHSTLYACLKYLKEKGDMKSAHEILRLLRKKGYLPTGSCDK 338 Query: 510 LVNYIHDG 487 L NY+ G Sbjct: 339 LENYVDGG 346 >ref|XP_002517927.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542909|gb|EEF44445.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 507 Score = 62.8 bits (151), Expect = 1e-07 Identities = 31/61 (50%), Positives = 41/61 (67%) Frame = -3 Query: 687 AVEMMKKAIQVLRPGWKLNRDTFAACLDFLKGKGDVEVAEEFIKLLKEQDHLEKNTCNKL 508 AVEM+KKAI V R GWK N T CLD+L+ +GDVE EE +K LK + L ++ ++L Sbjct: 413 AVEMLKKAISVSRKGWKPNPITLTTCLDYLEEQGDVEGIEEIVKSLKSTESLTRDIYHRL 472 Query: 507 V 505 V Sbjct: 473 V 473 >ref|XP_002531595.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528791|gb|EEF30798.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 176 Score = 62.4 bits (150), Expect = 1e-07 Identities = 32/64 (50%), Positives = 45/64 (70%) Frame = -3 Query: 687 AVEMMKKAIQVLRPGWKLNRDTFAACLDFLKGKGDVEVAEEFIKLLKEQDHLEKNTCNKL 508 AVEMMKKA++V K + ++ A+CL++LKGKGD+E AEE IKLL + D + + KL Sbjct: 89 AVEMMKKALEVSGSKLKSSSESLASCLEYLKGKGDLEKAEELIKLLLDNDIISLDIQEKL 148 Query: 507 VNYI 496 +N I Sbjct: 149 LNNI 152 >ref|XP_006376506.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550325782|gb|ERP54303.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 501 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/66 (46%), Positives = 45/66 (68%) Frame = -3 Query: 687 AVEMMKKAIQVLRPGWKLNRDTFAACLDFLKGKGDVEVAEEFIKLLKEQDHLEKNTCNKL 508 A E +KKAI + +PGWK N T AACL++LKG+ DV+ E+ +K+LKE HL + ++L Sbjct: 399 ASETIKKAISISQPGWKPNVYTLAACLEYLKGREDVKKIEDPLKILKEHCHLSSVSYDRL 458 Query: 507 VNYIHD 490 + I D Sbjct: 459 NSSIID 464 >ref|XP_006377348.1| hypothetical protein POPTR_0011s05140g [Populus trichocarpa] gi|550327636|gb|ERP55145.1| hypothetical protein POPTR_0011s05140g [Populus trichocarpa] Length = 281 Score = 60.8 bits (146), Expect = 4e-07 Identities = 33/63 (52%), Positives = 42/63 (66%) Frame = -3 Query: 684 VEMMKKAIQVLRPGWKLNRDTFAACLDFLKGKGDVEVAEEFIKLLKEQDHLEKNTCNKLV 505 VE MKKAI V PGWK ++T A+CLD L+GKGD AEEFI+LL+ ++ N+L Sbjct: 209 VEAMKKAILVC-PGWKPIKETLASCLDHLEGKGDQNKAEEFIELLRTENIFSPVAHNRLR 267 Query: 504 NYI 496 YI Sbjct: 268 TYI 270 >ref|XP_002517926.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542908|gb|EEF44444.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 504 Score = 60.1 bits (144), Expect = 7e-07 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = -3 Query: 687 AVEMMKKAIQVLRPGWKLNRDTFAACLDFLKGKGDVEVAEEFIKLLKE 544 AVE ++KAI V +PGWK + T +ACL+FLKG+GD E EE +K+ KE Sbjct: 405 AVETIRKAISVSKPGWKPSLLTLSACLEFLKGQGDAETLEELLKIAKE 452 >ref|XP_004487291.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cicer arietinum] Length = 492 Score = 58.9 bits (141), Expect = 2e-06 Identities = 30/70 (42%), Positives = 41/70 (58%), Gaps = 9/70 (12%) Frame = -3 Query: 675 MKKAIQVL---------RPGWKLNRDTFAACLDFLKGKGDVEVAEEFIKLLKEQDHLEKN 523 M+KA+Q + R GWK N T AC+ +LK K DVE A E +KL KE H+ Sbjct: 394 MEKAVQTMKKITSGSRQRRGWKPNTYTLCACIKYLKEKVDVEQALEILKLFKEDGHISAT 453 Query: 522 TCNKLVNYIH 493 T ++LV+Y+H Sbjct: 454 TYDRLVSYVH 463