BLASTX nr result
ID: Paeonia24_contig00036505
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00036505 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317252.2| hypothetical protein POPTR_0011s04040g [Popu... 59 9e-07 ref|XP_002526857.1| conserved hypothetical protein [Ricinus comm... 56 5e-06 ref|XP_006646671.1| PREDICTED: uncharacterized protein LOC102705... 55 8e-06 ref|XP_002458636.1| hypothetical protein SORBIDRAFT_03g037130 [S... 55 8e-06 >ref|XP_002317252.2| hypothetical protein POPTR_0011s04040g [Populus trichocarpa] gi|550327546|gb|EEE97864.2| hypothetical protein POPTR_0011s04040g [Populus trichocarpa] Length = 818 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/40 (62%), Positives = 29/40 (72%) Frame = -1 Query: 120 RENFDSLDSTYKNCLLCFAAFPENEVVKKRFLISWWVAEG 1 +E + SLD K CLLCF+ FPEN VVKKR L+ WWV EG Sbjct: 327 KERYSSLDLRDKLCLLCFSVFPENSVVKKRLLMYWWVGEG 366 >ref|XP_002526857.1| conserved hypothetical protein [Ricinus communis] gi|223533756|gb|EEF35488.1| conserved hypothetical protein [Ricinus communis] Length = 720 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/43 (53%), Positives = 29/43 (67%) Frame = -1 Query: 129 EISRENFDSLDSTYKNCLLCFAAFPENEVVKKRFLISWWVAEG 1 E E F+ L +Y++CLLCF+ FPE VV KR L+ WWV EG Sbjct: 203 EYFEETFERLTPSYQHCLLCFSVFPEGAVVSKRMLMYWWVGEG 245 >ref|XP_006646671.1| PREDICTED: uncharacterized protein LOC102705874 [Oryza brachyantha] Length = 866 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/40 (57%), Positives = 26/40 (65%) Frame = -1 Query: 120 RENFDSLDSTYKNCLLCFAAFPENEVVKKRFLISWWVAEG 1 R D+LD CLLC A FP NEV+KKR LI WW+ EG Sbjct: 116 RRLLDALDGQLLQCLLCLAIFPPNEVIKKRILIHWWIGEG 155 >ref|XP_002458636.1| hypothetical protein SORBIDRAFT_03g037130 [Sorghum bicolor] gi|241930611|gb|EES03756.1| hypothetical protein SORBIDRAFT_03g037130 [Sorghum bicolor] Length = 622 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/38 (55%), Positives = 28/38 (73%) Frame = -1 Query: 114 NFDSLDSTYKNCLLCFAAFPENEVVKKRFLISWWVAEG 1 ++D+LD K CLLCF+ FPEN +V KR +I WW+ EG Sbjct: 162 SYDNLDLQLKLCLLCFSVFPENSIVSKRAMIHWWIGEG 199