BLASTX nr result
ID: Paeonia24_contig00036195
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00036195 (216 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004303869.1| PREDICTED: glycerol-3-phosphate acyltransfer... 60 3e-07 ref|XP_007216827.1| hypothetical protein PRUPE_ppa022841mg [Prun... 60 4e-07 >ref|XP_004303869.1| PREDICTED: glycerol-3-phosphate acyltransferase 1-like [Fragaria vesca subsp. vesca] Length = 532 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = -1 Query: 111 KKQSLTTVGHYFTGFLSGSSLLMKHRALKEHFGERKP 1 K L T GHYFTG LS S LLMKHRALKEHFG+RKP Sbjct: 180 KGTELLTSGHYFTGLLSKSGLLMKHRALKEHFGDRKP 216 >ref|XP_007216827.1| hypothetical protein PRUPE_ppa022841mg [Prunus persica] gi|462412977|gb|EMJ18026.1| hypothetical protein PRUPE_ppa022841mg [Prunus persica] Length = 545 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 99 LTTVGHYFTGFLSGSSLLMKHRALKEHFGERKP 1 L TVGHYFTGFLS S L+KHRALKEHFG++KP Sbjct: 196 LQTVGHYFTGFLSKSGFLVKHRALKEHFGDKKP 228