BLASTX nr result
ID: Paeonia24_contig00035328
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00035328 (272 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007219089.1| hypothetical protein PRUPE_ppa015100mg, part... 83 5e-14 ref|XP_007226950.1| hypothetical protein PRUPE_ppa025194mg, part... 81 2e-13 ref|XP_007224256.1| hypothetical protein PRUPE_ppa018408mg, part... 81 2e-13 ref|XP_007219137.1| hypothetical protein PRUPE_ppa015965mg [Prun... 81 2e-13 ref|XP_007203318.1| hypothetical protein PRUPE_ppa019964mg, part... 81 2e-13 gb|AGX45504.1| reverse transcriptase, partial [Prunus salicina] 78 1e-12 gb|AGX45503.1| reverse transcriptase, partial [Prunus salicina] 78 1e-12 gb|AAX62227.1| reverse transcriptase [Sciadopitys verticillata] ... 77 3e-12 gb|AGX45502.1| reverse transcriptase, partial [Prunus salicina] 75 7e-12 gb|AGX45499.1| reverse transcriptase, partial [Prunus salicina] 74 2e-11 gb|AGX45501.1| reverse transcriptase, partial [Prunus salicina] 74 3e-11 gb|ABD63133.1| hypothetical protein 19.t00005 [Asparagus officin... 74 3e-11 gb|ACU42190.1| reverse transcriptase [Prunus mume] 74 3e-11 gb|ACU42187.1| reverse transcriptase [Prunus mume] 74 3e-11 gb|ACU42185.1| reverse transcriptase [Prunus mume] 74 3e-11 gb|ACU42183.1| reverse transcriptase [Prunus mume] gi|255928612|... 74 3e-11 gb|ACU42182.1| reverse transcriptase [Prunus mume] 74 3e-11 gb|ACU42179.1| reverse transcriptase [Prunus mume] 74 3e-11 gb|ACU42178.1| reverse transcriptase [Prunus mume] gi|255928610|... 74 3e-11 gb|AAX62226.1| reverse transcriptase [Pinus radiata] 73 4e-11 >ref|XP_007219089.1| hypothetical protein PRUPE_ppa015100mg, partial [Prunus persica] gi|462415551|gb|EMJ20288.1| hypothetical protein PRUPE_ppa015100mg, partial [Prunus persica] Length = 641 Score = 82.8 bits (203), Expect = 5e-14 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -2 Query: 271 MFVDYRALNGITIKNRYPVLRIDDLLDQL*GSHFFTKLDLKSDYHQV 131 M+VDYRALN ITIKNRYP+ RIDDLLDQL G+H+FTKLDLKS YHQV Sbjct: 211 MYVDYRALNKITIKNRYPLPRIDDLLDQLHGAHYFTKLDLKSGYHQV 257 >ref|XP_007226950.1| hypothetical protein PRUPE_ppa025194mg, partial [Prunus persica] gi|462423886|gb|EMJ28149.1| hypothetical protein PRUPE_ppa025194mg, partial [Prunus persica] Length = 1347 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = -2 Query: 271 MFVDYRALNGITIKNRYPVLRIDDLLDQL*GSHFFTKLDLKSDYHQV 131 M VDYRALN ITIKNRYP+ RIDDLLDQL G+H+FTKLDLKS YHQV Sbjct: 564 MCVDYRALNKITIKNRYPLPRIDDLLDQLHGAHYFTKLDLKSGYHQV 610 >ref|XP_007224256.1| hypothetical protein PRUPE_ppa018408mg, partial [Prunus persica] gi|462421192|gb|EMJ25455.1| hypothetical protein PRUPE_ppa018408mg, partial [Prunus persica] Length = 1440 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = -2 Query: 271 MFVDYRALNGITIKNRYPVLRIDDLLDQL*GSHFFTKLDLKSDYHQV 131 M VDYRALN ITIKNRYP+ RIDDLLDQL G+H+FTKLDLKS YHQV Sbjct: 637 MCVDYRALNKITIKNRYPLPRIDDLLDQLHGAHYFTKLDLKSGYHQV 683 >ref|XP_007219137.1| hypothetical protein PRUPE_ppa015965mg [Prunus persica] gi|462415599|gb|EMJ20336.1| hypothetical protein PRUPE_ppa015965mg [Prunus persica] Length = 1484 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = -2 Query: 271 MFVDYRALNGITIKNRYPVLRIDDLLDQL*GSHFFTKLDLKSDYHQV 131 M VDYRALN ITIKNRYP+ RIDDLLDQL G+H+FTKLDLKS YHQV Sbjct: 650 MCVDYRALNKITIKNRYPLPRIDDLLDQLHGAHYFTKLDLKSGYHQV 696 >ref|XP_007203318.1| hypothetical protein PRUPE_ppa019964mg, partial [Prunus persica] gi|462398849|gb|EMJ04517.1| hypothetical protein PRUPE_ppa019964mg, partial [Prunus persica] Length = 1488 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = -2 Query: 271 MFVDYRALNGITIKNRYPVLRIDDLLDQL*GSHFFTKLDLKSDYHQV 131 M VDYRALN ITIKNRYP+ RIDDLLDQL G+H+FTKLDLKS YHQV Sbjct: 637 MCVDYRALNKITIKNRYPLPRIDDLLDQLHGAHYFTKLDLKSGYHQV 683 >gb|AGX45504.1| reverse transcriptase, partial [Prunus salicina] Length = 143 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/47 (80%), Positives = 41/47 (87%) Frame = -2 Query: 271 MFVDYRALNGITIKNRYPVLRIDDLLDQL*GSHFFTKLDLKSDYHQV 131 M VDYRALN ITIKNRYP+ RIDDLLDQL G+ +FTKLDLKS YHQV Sbjct: 2 MCVDYRALNKITIKNRYPLPRIDDLLDQLHGARYFTKLDLKSGYHQV 48 >gb|AGX45503.1| reverse transcriptase, partial [Prunus salicina] Length = 143 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/47 (80%), Positives = 41/47 (87%) Frame = -2 Query: 271 MFVDYRALNGITIKNRYPVLRIDDLLDQL*GSHFFTKLDLKSDYHQV 131 M VDYRALN ITIKNRYP+ RIDDLLDQL G+ +FTKLDLKS YHQV Sbjct: 2 MCVDYRALNKITIKNRYPLPRIDDLLDQLHGARYFTKLDLKSGYHQV 48 >gb|AAX62227.1| reverse transcriptase [Sciadopitys verticillata] gi|62082800|gb|AAX62228.1| reverse transcriptase [Sciadopitys verticillata] Length = 116 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -2 Query: 265 VDYRALNGITIKNRYPVLRIDDLLDQL*GSHFFTKLDLKSDYHQV 131 +DYRALN IT+KNRYP+ RIDDLLDQL G+ FFTK+DLKS YHQV Sbjct: 8 IDYRALNKITVKNRYPIPRIDDLLDQLRGAKFFTKIDLKSGYHQV 52 >gb|AGX45502.1| reverse transcriptase, partial [Prunus salicina] Length = 143 Score = 75.5 bits (184), Expect = 7e-12 Identities = 37/47 (78%), Positives = 40/47 (85%) Frame = -2 Query: 271 MFVDYRALNGITIKNRYPVLRIDDLLDQL*GSHFFTKLDLKSDYHQV 131 M VDYRALN ITIKNRYP+ IDDLLDQL G+ +FTKLDLKS YHQV Sbjct: 2 MCVDYRALNKITIKNRYPLPMIDDLLDQLHGARYFTKLDLKSGYHQV 48 >gb|AGX45499.1| reverse transcriptase, partial [Prunus salicina] Length = 143 Score = 74.3 bits (181), Expect = 2e-11 Identities = 37/47 (78%), Positives = 40/47 (85%) Frame = -2 Query: 271 MFVDYRALNGITIKNRYPVLRIDDLLDQL*GSHFFTKLDLKSDYHQV 131 M VDYRALN ITIKNRYP+ RID LLDQL G+ +FTKLDLKS YHQV Sbjct: 2 MCVDYRALNKITIKNRYPLPRIDVLLDQLHGARYFTKLDLKSGYHQV 48 >gb|AGX45501.1| reverse transcriptase, partial [Prunus salicina] Length = 143 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = -2 Query: 271 MFVDYRALNGITIKNRYPVLRIDDLLDQL*GSHFFTKLDLKSDYHQV 131 M VDYR LN +TIKN+YP+ RIDDL DQL GSHFF+K+DL+S YHQ+ Sbjct: 2 MCVDYRQLNRVTIKNKYPLPRIDDLFDQLKGSHFFSKIDLRSGYHQL 48 >gb|ABD63133.1| hypothetical protein 19.t00005 [Asparagus officinalis] Length = 335 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 271 MFVDYRALNGITIKNRYPVLRIDDLLDQL*GSHFFTKLDLKSDYHQ 134 M +DYRALN ITIK+RYP+ RIDDL+DQL G+ FFTKLDLKS YHQ Sbjct: 60 MCMDYRALNKITIKDRYPLPRIDDLIDQLEGARFFTKLDLKSGYHQ 105 >gb|ACU42190.1| reverse transcriptase [Prunus mume] Length = 143 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = -2 Query: 271 MFVDYRALNGITIKNRYPVLRIDDLLDQL*GSHFFTKLDLKSDYHQV 131 M VDYR LN +TIKN+YP+ RIDDL DQL GSHFF+K+DL+S YHQ+ Sbjct: 2 MCVDYRQLNRVTIKNKYPLPRIDDLFDQLRGSHFFSKIDLRSGYHQL 48 >gb|ACU42187.1| reverse transcriptase [Prunus mume] Length = 143 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = -2 Query: 271 MFVDYRALNGITIKNRYPVLRIDDLLDQL*GSHFFTKLDLKSDYHQV 131 M VDYR LN +TIKN+YP+ RIDDL DQL GSHFF+K+DL+S YHQ+ Sbjct: 2 MCVDYRQLNRVTIKNKYPLPRIDDLFDQLRGSHFFSKIDLRSGYHQL 48 >gb|ACU42185.1| reverse transcriptase [Prunus mume] Length = 143 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = -2 Query: 271 MFVDYRALNGITIKNRYPVLRIDDLLDQL*GSHFFTKLDLKSDYHQV 131 M VDYR LN +TIKN+YP+ RIDDL DQL GSHFF+K+DL+S YHQ+ Sbjct: 2 MCVDYRQLNRVTIKNKYPLPRIDDLFDQLRGSHFFSKIDLRSGYHQL 48 >gb|ACU42183.1| reverse transcriptase [Prunus mume] gi|255928612|gb|ACU42194.1| reverse transcriptase [Prunus mume] Length = 143 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = -2 Query: 271 MFVDYRALNGITIKNRYPVLRIDDLLDQL*GSHFFTKLDLKSDYHQV 131 M VDYR LN +TIKN+YP+ RIDDL DQL GSHFF+K+DL+S YHQ+ Sbjct: 2 MCVDYRQLNRVTIKNKYPLPRIDDLFDQLRGSHFFSKIDLRSGYHQL 48 >gb|ACU42182.1| reverse transcriptase [Prunus mume] Length = 143 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = -2 Query: 271 MFVDYRALNGITIKNRYPVLRIDDLLDQL*GSHFFTKLDLKSDYHQV 131 M VDYR LN +TIKN+YP+ RIDDL DQL GSHFF+K+DL+S YHQ+ Sbjct: 2 MCVDYRQLNRVTIKNKYPLPRIDDLFDQLRGSHFFSKIDLRSGYHQL 48 >gb|ACU42179.1| reverse transcriptase [Prunus mume] Length = 143 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = -2 Query: 271 MFVDYRALNGITIKNRYPVLRIDDLLDQL*GSHFFTKLDLKSDYHQV 131 M VDYR LN +TIKN+YP+ RIDDL DQL GSHFF+K+DL+S YHQ+ Sbjct: 2 MCVDYRQLNRVTIKNKYPLPRIDDLFDQLRGSHFFSKIDLRSGYHQL 48 >gb|ACU42178.1| reverse transcriptase [Prunus mume] gi|255928610|gb|ACU42193.1| reverse transcriptase [Prunus mume] Length = 143 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = -2 Query: 271 MFVDYRALNGITIKNRYPVLRIDDLLDQL*GSHFFTKLDLKSDYHQV 131 M VDYR LN +TIKN+YP+ RIDDL DQL GSHFF+K+DL+S YHQ+ Sbjct: 2 MCVDYRQLNRVTIKNKYPLPRIDDLFDQLRGSHFFSKIDLRSGYHQL 48 >gb|AAX62226.1| reverse transcriptase [Pinus radiata] Length = 117 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = -2 Query: 265 VDYRALNGITIKNRYPVLRIDDLLDQL*GSHFFTKLDLKSDYHQV 131 VDYRALN IT++NRYP+ RIDDLLDQL G+ +F+K+DLKS YHQV Sbjct: 8 VDYRALNKITVRNRYPIPRIDDLLDQLKGAKYFSKIDLKSGYHQV 52