BLASTX nr result
ID: Paeonia24_contig00034948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00034948 (413 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004486634.1| PREDICTED: uncharacterized protein LOC101503... 56 6e-06 ref|XP_004486633.1| PREDICTED: uncharacterized protein LOC101503... 56 6e-06 >ref|XP_004486634.1| PREDICTED: uncharacterized protein LOC101503108 isoform X2 [Cicer arietinum] Length = 215 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/52 (46%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = -2 Query: 154 NTMNTDNLRQTQGL-PNLESSGWRTQLQVEAREKIVVNVFEILKKHIPSTGE 2 N MN++N R QG PN++SS WR QLQ E+R+++V + + LK+H+P +G+ Sbjct: 118 NLMNSNNWRLNQGAEPNMDSSDWRGQLQPESRQRVVNKIMDTLKRHLPDSGQ 169 >ref|XP_004486633.1| PREDICTED: uncharacterized protein LOC101503108 isoform X1 [Cicer arietinum] Length = 234 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/52 (46%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = -2 Query: 154 NTMNTDNLRQTQGL-PNLESSGWRTQLQVEAREKIVVNVFEILKKHIPSTGE 2 N MN++N R QG PN++SS WR QLQ E+R+++V + + LK+H+P +G+ Sbjct: 118 NLMNSNNWRLNQGAEPNMDSSDWRGQLQPESRQRVVNKIMDTLKRHLPDSGQ 169