BLASTX nr result
ID: Paeonia24_contig00033930
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00033930 (204 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511180.1| conserved hypothetical protein [Ricinus comm... 59 7e-07 >ref|XP_002511180.1| conserved hypothetical protein [Ricinus communis] gi|223550295|gb|EEF51782.1| conserved hypothetical protein [Ricinus communis] Length = 416 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +2 Query: 59 LPQISTTTSKTAGGNVHSGAPPPWLEATDNNQSDVQQKPV 178 + QIST +K AG NVHSGAPPPWLEAT+ NQ +VQ +P+ Sbjct: 275 MTQISTMPAKEAGINVHSGAPPPWLEATEENQLNVQLRPI 314