BLASTX nr result
ID: Paeonia24_contig00033676
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00033676 (299 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC20955.1| Putative kinase-like protein TMKL1 [Morus notabilis] 55 8e-06 ref|XP_006421583.1| hypothetical protein CICLE_v10005242mg [Citr... 55 8e-06 ref|XP_006385120.1| hypothetical protein POPTR_0004s24110g [Popu... 55 8e-06 >gb|EXC20955.1| Putative kinase-like protein TMKL1 [Morus notabilis] Length = 370 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 KFFRLAMACCSPSPPLRPDIKQVMKKLVEIGR 96 KFF+LAMACCSPSP LRP+IKQV+ KL EIG+ Sbjct: 339 KFFQLAMACCSPSPSLRPNIKQVLWKLEEIGK 370 >ref|XP_006421583.1| hypothetical protein CICLE_v10005242mg [Citrus clementina] gi|557523456|gb|ESR34823.1| hypothetical protein CICLE_v10005242mg [Citrus clementina] Length = 361 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +1 Query: 1 KFFRLAMACCSPSPPLRPDIKQVMKKLVEIGR 96 KFF+LAMACCSPSP LRP+IKQV++KL ++G+ Sbjct: 330 KFFQLAMACCSPSPSLRPNIKQVLRKLEDLGK 361 >ref|XP_006385120.1| hypothetical protein POPTR_0004s24110g [Populus trichocarpa] gi|550341888|gb|ERP62917.1| hypothetical protein POPTR_0004s24110g [Populus trichocarpa] Length = 362 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 KFFRLAMACCSPSPPLRPDIKQVMKKLVEIGR 96 K+F+LAMACCSPSP LRP+IKQV+ KL EIGR Sbjct: 330 KYFQLAMACCSPSPSLRPNIKQVLWKLEEIGR 361