BLASTX nr result
ID: Paeonia24_contig00032477
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00032477 (296 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526502.1| Pectinesterase inhibitor, putative [Ricinus ... 82 1e-13 ref|XP_004307269.1| PREDICTED: putative invertase inhibitor-like... 81 2e-13 ref|XP_006445480.1| hypothetical protein CICLE_v10023652mg [Citr... 79 9e-13 ref|XP_007052414.1| Plant invertase/pectin methylesterase inhibi... 76 4e-12 ref|XP_007220803.1| hypothetical protein PRUPE_ppb019226mg [Prun... 74 2e-11 ref|XP_006375099.1| invertase/pectin methylesterase inhibitor fa... 74 2e-11 ref|XP_002266018.1| PREDICTED: putative invertase inhibitor-like... 73 5e-11 ref|XP_006354680.1| PREDICTED: putative invertase inhibitor-like... 72 1e-10 ref|XP_004229708.1| PREDICTED: putative invertase inhibitor-like... 72 1e-10 ref|XP_003626807.1| Pectinesterase inhibitor [Medicago truncatul... 70 4e-10 gb|EPS72175.1| hypothetical protein M569_02589, partial [Genlise... 69 7e-10 ref|XP_006354637.1| PREDICTED: putative invertase inhibitor-like... 67 3e-09 emb|CAA56643.1| sts15 [Solanum tuberosum] 67 3e-09 ref|NP_001235997.1| uncharacterized protein LOC100306248 precurs... 66 6e-09 gb|ABI17896.1| invertase inhibitor [Coffea canephora] 65 1e-08 gb|EYU42317.1| hypothetical protein MIMGU_mgv1a026284mg [Mimulus... 64 2e-08 gb|EYU40322.1| hypothetical protein MIMGU_mgv1a014543mg [Mimulus... 63 4e-08 ref|XP_004510139.1| PREDICTED: putative invertase inhibitor-like... 63 4e-08 ref|XP_007134365.1| hypothetical protein PHAVU_010G041500g [Phas... 60 3e-07 gb|EXB70718.1| Putative invertase inhibitor [Morus notabilis] 56 5e-06 >ref|XP_002526502.1| Pectinesterase inhibitor, putative [Ricinus communis] gi|223534177|gb|EEF35893.1| Pectinesterase inhibitor, putative [Ricinus communis] Length = 176 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/57 (66%), Positives = 43/57 (75%) Frame = +2 Query: 125 QETCNKTARNDPNVSYKFCVTSLQAVPDRPCANLRHLGLISIKLARRNATDTRSYIK 295 QETCNK A NDPN+SY FC+TSL+A P CA+L LG+ISI L R N TDTR YIK Sbjct: 26 QETCNKCAINDPNISYDFCLTSLRASPGSHCASLSELGMISINLTRHNVTDTRRYIK 82 >ref|XP_004307269.1| PREDICTED: putative invertase inhibitor-like [Fragaria vesca subsp. vesca] Length = 187 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/56 (66%), Positives = 45/56 (80%) Frame = +2 Query: 128 ETCNKTARNDPNVSYKFCVTSLQAVPDRPCANLRHLGLISIKLARRNATDTRSYIK 295 ETC K A+NDPN+SYKFC+TSLQA P+ P A+LR LGLIS+KL + N T+T YIK Sbjct: 34 ETCKKAAQNDPNLSYKFCLTSLQAAPNSPGADLRQLGLISMKLVQHNVTNTSRYIK 89 >ref|XP_006445480.1| hypothetical protein CICLE_v10023652mg [Citrus clementina] gi|557547742|gb|ESR58720.1| hypothetical protein CICLE_v10023652mg [Citrus clementina] Length = 187 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/56 (66%), Positives = 42/56 (75%) Frame = +2 Query: 128 ETCNKTARNDPNVSYKFCVTSLQAVPDRPCANLRHLGLISIKLARRNATDTRSYIK 295 ETC K A+NDPN+S+ FCVTSLQA CANL LG+IS+KL R N T TRSYIK Sbjct: 37 ETCKKCAQNDPNISHNFCVTSLQADAKSQCANLGELGMISMKLTRENVTKTRSYIK 92 >ref|XP_007052414.1| Plant invertase/pectin methylesterase inhibitor superfamily protein [Theobroma cacao] gi|508704675|gb|EOX96571.1| Plant invertase/pectin methylesterase inhibitor superfamily protein [Theobroma cacao] Length = 189 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/58 (62%), Positives = 45/58 (77%), Gaps = 1/58 (1%) Frame = +2 Query: 125 QETCNKTARNDPNVSYKFCVTSLQAVPDRPCA-NLRHLGLISIKLARRNATDTRSYIK 295 +ETC K A DPN+SY FCVTSLQA P CA +LR LG++SI+L RRN T+TRSY++ Sbjct: 34 RETCKKCAGRDPNLSYNFCVTSLQAAPKSHCADDLRDLGMVSIRLVRRNLTNTRSYVE 91 >ref|XP_007220803.1| hypothetical protein PRUPE_ppb019226mg [Prunus persica] gi|462417265|gb|EMJ22002.1| hypothetical protein PRUPE_ppb019226mg [Prunus persica] Length = 191 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/56 (58%), Positives = 43/56 (76%) Frame = +2 Query: 128 ETCNKTARNDPNVSYKFCVTSLQAVPDRPCANLRHLGLISIKLARRNATDTRSYIK 295 +TC K ++DPN+SYKFCVTSLQA P+ A++R LG+IS+ L R+N T TR YIK Sbjct: 34 DTCKKCVQDDPNLSYKFCVTSLQAAPNSSSADVRQLGIISMNLIRQNMTSTRQYIK 89 >ref|XP_006375099.1| invertase/pectin methylesterase inhibitor family protein [Populus trichocarpa] gi|550323414|gb|ERP52896.1| invertase/pectin methylesterase inhibitor family protein [Populus trichocarpa] Length = 180 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/56 (62%), Positives = 41/56 (73%) Frame = +2 Query: 128 ETCNKTARNDPNVSYKFCVTSLQAVPDRPCANLRHLGLISIKLARRNATDTRSYIK 295 ETC K A NDPN+SY FCVTSLQA C NLR LG++SIKL + N T+TR Y+K Sbjct: 31 ETCKKCAANDPNLSYNFCVTSLQASNRSQCDNLRGLGMMSIKLIKYNVTNTRHYVK 86 >ref|XP_002266018.1| PREDICTED: putative invertase inhibitor-like [Vitis vinifera] Length = 182 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/56 (60%), Positives = 42/56 (75%) Frame = +2 Query: 128 ETCNKTARNDPNVSYKFCVTSLQAVPDRPCANLRHLGLISIKLARRNATDTRSYIK 295 ETC ++ ND N SY+FC TSLQA P CA+LR LGLI+I+L R NATDTR +I+ Sbjct: 32 ETCKNSSHNDSNFSYRFCKTSLQAAPASRCASLRGLGLIAIRLFRDNATDTRCFIR 87 >ref|XP_006354680.1| PREDICTED: putative invertase inhibitor-like [Solanum tuberosum] Length = 188 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/57 (52%), Positives = 41/57 (71%) Frame = +2 Query: 125 QETCNKTARNDPNVSYKFCVTSLQAVPDRPCANLRHLGLISIKLARRNATDTRSYIK 295 Q TC +++DPN+ Y+FC +S+QA P CA LR LG+ISI+L R N TDTR ++K Sbjct: 29 QNTCKSCSKDDPNIKYEFCTSSIQAAPASQCATLRGLGMISIRLIRYNVTDTRCHVK 85 >ref|XP_004229708.1| PREDICTED: putative invertase inhibitor-like [Solanum lycopersicum] Length = 186 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/57 (56%), Positives = 39/57 (68%) Frame = +2 Query: 125 QETCNKTARNDPNVSYKFCVTSLQAVPDRPCANLRHLGLISIKLARRNATDTRSYIK 295 Q TC A +DPN+ Y FC +SLQA P CA LR LG+ISI+L R N TDTR ++K Sbjct: 29 QNTCKSCANDDPNIKYGFCTSSLQAAPASQCATLRGLGMISIRLIRYNVTDTRCHVK 85 >ref|XP_003626807.1| Pectinesterase inhibitor [Medicago truncatula] gi|355520829|gb|AET01283.1| Pectinesterase inhibitor [Medicago truncatula] gi|388503216|gb|AFK39674.1| unknown [Medicago truncatula] Length = 189 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/58 (56%), Positives = 42/58 (72%), Gaps = 1/58 (1%) Frame = +2 Query: 125 QETCNKTARNDPNVSYKFCVTSLQAVPDRPCA-NLRHLGLISIKLARRNATDTRSYIK 295 Q+TC +++DPN+SYKFC+TSLQ+ CA NL LGLISIK+ R N T+T YIK Sbjct: 29 QQTCKNCSKSDPNISYKFCITSLQSDHRTQCAKNLEELGLISIKITRHNVTNTCDYIK 86 >gb|EPS72175.1| hypothetical protein M569_02589, partial [Genlisea aurea] Length = 164 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/56 (58%), Positives = 40/56 (71%), Gaps = 1/56 (1%) Frame = +2 Query: 131 TCNKTARNDPNVSYKFCVTSLQAVPDRPC-ANLRHLGLISIKLARRNATDTRSYIK 295 TC K A+ DPN+ Y FC TSLQ+ P PC A+LR LG ISI+L R N T+TR YI+ Sbjct: 7 TCKKLAKEDPNIHYAFCTTSLQSAPASPCAADLRALGSISIRLLRDNVTNTRCYIR 62 >ref|XP_006354637.1| PREDICTED: putative invertase inhibitor-like [Solanum tuberosum] Length = 183 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/57 (50%), Positives = 40/57 (70%) Frame = +2 Query: 125 QETCNKTARNDPNVSYKFCVTSLQAVPDRPCANLRHLGLISIKLARRNATDTRSYIK 295 Q TC ++N+ +++Y FC +SLQA P CA LR LG+ISI+L R N TDTR ++K Sbjct: 28 QTTCKSCSKNESSITYGFCTSSLQAAPASQCATLRGLGMISIRLIRYNVTDTRCHVK 84 >emb|CAA56643.1| sts15 [Solanum tuberosum] Length = 183 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/57 (50%), Positives = 40/57 (70%) Frame = +2 Query: 125 QETCNKTARNDPNVSYKFCVTSLQAVPDRPCANLRHLGLISIKLARRNATDTRSYIK 295 Q TC ++N+ +++Y FC +SLQA P CA LR LG+ISI+L R N TDTR ++K Sbjct: 28 QTTCKSCSKNESSITYGFCTSSLQAAPASQCATLRGLGMISIRLIRYNVTDTRCHVK 84 >ref|NP_001235997.1| uncharacterized protein LOC100306248 precursor [Glycine max] gi|255627995|gb|ACU14342.1| unknown [Glycine max] Length = 187 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/57 (56%), Positives = 41/57 (71%), Gaps = 1/57 (1%) Frame = +2 Query: 125 QETCNKTARNDPNVSYKFCVTSLQAVPDRPCA-NLRHLGLISIKLARRNATDTRSYI 292 Q+TC ++NDPN+SYKFCVTS Q+ A NL+ LGLISIK+ R N TDT ++I Sbjct: 30 QQTCKNCSKNDPNISYKFCVTSFQSDHRSHYAKNLQELGLISIKITRHNVTDTNAHI 86 >gb|ABI17896.1| invertase inhibitor [Coffea canephora] Length = 185 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = +2 Query: 125 QETCNKTARNDPNVSYKFCVTSLQAVPDRPCANLRHLGLISIKLARRNATDTRSYIK 295 +++C A++DPN+++ FC TSLQA P CA LR LG IS +L R N TDTR I+ Sbjct: 30 RDSCRTFAKDDPNINFNFCTTSLQAAPASHCAALRGLGTISFRLIRYNVTDTRCMIR 86 >gb|EYU42317.1| hypothetical protein MIMGU_mgv1a026284mg [Mimulus guttatus] Length = 182 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/55 (54%), Positives = 36/55 (65%) Frame = +2 Query: 131 TCNKTARNDPNVSYKFCVTSLQAVPDRPCANLRHLGLISIKLARRNATDTRSYIK 295 TC + +DPN+ Y FC TSL A P CA L+ LG ISI+L R N TDTR +IK Sbjct: 27 TCKTASNDDPNIPYAFCTTSLLAAPASRCAALQGLGSISIRLIRYNVTDTRCFIK 81 >gb|EYU40322.1| hypothetical protein MIMGU_mgv1a014543mg [Mimulus guttatus] Length = 186 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/54 (51%), Positives = 36/54 (66%) Frame = +2 Query: 131 TCNKTARNDPNVSYKFCVTSLQAVPDRPCANLRHLGLISIKLARRNATDTRSYI 292 TC ++NDPN++Y FC TSLQA CA L+ LG IS++L N TDTR +I Sbjct: 33 TCKTLSKNDPNINYTFCTTSLQAAAASRCATLQGLGTISVRLLSHNITDTRRHI 86 >ref|XP_004510139.1| PREDICTED: putative invertase inhibitor-like [Cicer arietinum] Length = 189 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/58 (51%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Frame = +2 Query: 125 QETCNKTARNDPNVSYKFCVTSLQAVPDRPCA-NLRHLGLISIKLARRNATDTRSYIK 295 Q+TC +++DPN+SYKFC SLQ+ CA NL LGLI+IK+ R N T+T +IK Sbjct: 29 QQTCKNCSKSDPNISYKFCTKSLQSDHRSQCAKNLEELGLITIKITRHNVTNTCDHIK 86 >ref|XP_007134365.1| hypothetical protein PHAVU_010G041500g [Phaseolus vulgaris] gi|561007410|gb|ESW06359.1| hypothetical protein PHAVU_010G041500g [Phaseolus vulgaris] Length = 189 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/57 (47%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = +2 Query: 125 QETCNKTARNDPNVSYKFCVTSLQA-VPDRPCANLRHLGLISIKLARRNATDTRSYI 292 Q+TC ++ DPN+SYKFCV S Q+ + NL LGLI++K+ R N TDT ++I Sbjct: 31 QQTCKNCSKTDPNISYKFCVASFQSNHRSQHAKNLEELGLIAVKITRHNVTDTNAHI 87 >gb|EXB70718.1| Putative invertase inhibitor [Morus notabilis] Length = 191 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/59 (42%), Positives = 39/59 (66%), Gaps = 2/59 (3%) Frame = +2 Query: 125 QETCNKTARNDPNVSYKFCVTSLQAVP--DRPCANLRHLGLISIKLARRNATDTRSYIK 295 ++TC + ++ DPN+ Y+FC SL++ P R ++L LGL+S L R N T TR++IK Sbjct: 35 RDTCRQCSKTDPNLDYEFCTNSLESSPYSRRYSSDLHQLGLLSFNLTRHNVTSTRNFIK 93