BLASTX nr result
ID: Paeonia24_contig00032112
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00032112 (325 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003606042.1| Ribosomal protein S4 [Medicago truncatula] g... 56 6e-06 >ref|XP_003606042.1| Ribosomal protein S4 [Medicago truncatula] gi|358349397|ref|XP_003638724.1| Ribosomal protein S4 [Medicago truncatula] gi|355504659|gb|AES85862.1| Ribosomal protein S4 [Medicago truncatula] gi|355507097|gb|AES88239.1| Ribosomal protein S4 [Medicago truncatula] Length = 234 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/32 (93%), Positives = 30/32 (93%), Gaps = 1/32 (3%) Frame = +1 Query: 97 M*ARLAQRLEHRICNAMVIGSIPIAG-FSLFV 189 M ARLAQRLEHRICNAMVIGSIPIAG FSLFV Sbjct: 1 MRARLAQRLEHRICNAMVIGSIPIAGFFSLFV 32