BLASTX nr result
ID: Paeonia24_contig00031448
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00031448 (219 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523966.1| utp-glucose-1-phosphate uridylyltransferase,... 50 2e-06 >ref|XP_002523966.1| utp-glucose-1-phosphate uridylyltransferase, putative [Ricinus communis] gi|223536693|gb|EEF38334.1| utp-glucose-1-phosphate uridylyltransferase, putative [Ricinus communis] Length = 624 Score = 50.1 bits (118), Expect(2) = 2e-06 Identities = 22/31 (70%), Positives = 25/31 (80%) Frame = -1 Query: 213 GTVQLSEIARNPSNSSMEKFKLIDTRNLWVN 121 G QL+EI +NPS +MEKFK IDTRNLWVN Sbjct: 428 GRFQLTEITQNPSKHAMEKFKFIDTRNLWVN 458 Score = 27.3 bits (59), Expect(2) = 2e-06 Identities = 10/15 (66%), Positives = 15/15 (100%) Frame = -2 Query: 47 WVNLKAIKKLVETES 3 WVNLKAI++LV+T++ Sbjct: 456 WVNLKAIQRLVDTDA 470