BLASTX nr result
ID: Paeonia24_contig00031367
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00031367 (373 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006428178.1| hypothetical protein CICLE_v10027550mg [Citr... 55 8e-06 >ref|XP_006428178.1| hypothetical protein CICLE_v10027550mg [Citrus clementina] gi|568819362|ref|XP_006464224.1| PREDICTED: protein spinster homolog 2-like [Citrus sinensis] gi|557530168|gb|ESR41418.1| hypothetical protein CICLE_v10027550mg [Citrus clementina] Length = 522 Score = 55.5 bits (132), Expect = 8e-06 Identities = 33/65 (50%), Positives = 40/65 (61%), Gaps = 9/65 (13%) Frame = -3 Query: 371 RMNTLIESEMQRIEADNAPLKE-YSHVHVLESDEFCRKE--------SSYETLELDDNDK 219 RM+ LIESEMQ++EADNAP E YS ES E K+ E+ ++DDNDK Sbjct: 448 RMDALIESEMQKLEADNAPSSEKYSQRQFSESKELNEKKVTDIDIEHGGEESTDIDDNDK 507 Query: 218 KSLLP 204 KSLLP Sbjct: 508 KSLLP 512