BLASTX nr result
ID: Paeonia24_contig00031228
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00031228 (216 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACO53610.1| biotin carboxyl carrier protein 1-2 [Arachis hypo... 70 3e-10 gb|ACO53609.1| biotin carboxyl carrier protein 1-1 [Arachis hypo... 70 3e-10 gb|ACN85391.1| acetyl-coenzyme A carboxylase [Suaeda salsa] 69 7e-10 ref|XP_007029254.1| Biotin carboxyl carrier protein subunit of o... 69 9e-10 ref|XP_007029252.1| Biotin carboxyl carrier protein subunit of o... 69 9e-10 gb|ABK26424.1| unknown [Picea sitchensis] 67 2e-09 gb|ADN52613.1| acetyl-CoA carboxylase BCCP subunit [Jatropha cur... 67 3e-09 ref|XP_002514825.1| Biotin carboxyl carrier protein subunit of o... 67 3e-09 gb|AFS89700.1| biotin carboxyl carrier protein [Vernicia fordii] 67 3e-09 gb|AGH32912.1| biotin carboxyl carrier protein subunit [Camellia... 67 3e-09 gb|AFP99173.1| biotin carboxyl carrier protein [Vernicia fordii] 67 3e-09 gb|ACT33948.1| biotin carboxyl carrier protein subunit [Jatropha... 67 3e-09 ref|XP_004489456.1| PREDICTED: biotin carboxyl carrier protein o... 66 4e-09 ref|XP_004489455.1| PREDICTED: biotin carboxyl carrier protein o... 66 4e-09 ref|NP_001241523.1| uncharacterized protein LOC100777962 [Glycin... 66 4e-09 ref|XP_003618716.1| Biotin carboxyl carrier protein of acetyl-Co... 66 4e-09 gb|EPS63946.1| hypothetical protein M569_10835 [Genlisea aurea] 66 6e-09 ref|XP_004489502.1| PREDICTED: biotin carboxyl carrier protein o... 66 6e-09 gb|ABU41516.1| biotin carboxyl carrier protein subunit [Gossypiu... 66 6e-09 gb|EYU39717.1| hypothetical protein MIMGU_mgv1a011080mg [Mimulus... 65 7e-09 >gb|ACO53610.1| biotin carboxyl carrier protein 1-2 [Arachis hypogaea] Length = 279 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 216 KLMNEIEADQSGTIVEVLVDDGKPVSVDMPLFVIEP 109 KLMNEIEADQSGTIVE+L +DGKPVSVDMPLFVIEP Sbjct: 244 KLMNEIEADQSGTIVEILAEDGKPVSVDMPLFVIEP 279 >gb|ACO53609.1| biotin carboxyl carrier protein 1-1 [Arachis hypogaea] Length = 279 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 216 KLMNEIEADQSGTIVEVLVDDGKPVSVDMPLFVIEP 109 KLMNEIEADQSGTIVE+L +DGKPVSVDMPLFVIEP Sbjct: 244 KLMNEIEADQSGTIVEILAEDGKPVSVDMPLFVIEP 279 >gb|ACN85391.1| acetyl-coenzyme A carboxylase [Suaeda salsa] Length = 257 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -1 Query: 216 KLMNEIEADQSGTIVEVLVDDGKPVSVDMPLFVIEP 109 KLMNEIEADQSGTIVE+L DGKPVSVDMPLFVIEP Sbjct: 222 KLMNEIEADQSGTIVEILAKDGKPVSVDMPLFVIEP 257 >ref|XP_007029254.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), putative isoform 3 [Theobroma cacao] gi|508717859|gb|EOY09756.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), putative isoform 3 [Theobroma cacao] Length = 310 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 216 KLMNEIEADQSGTIVEVLVDDGKPVSVDMPLFVIEP 109 KLMNEIEADQSGTIVE+LV+DGK VSVDMPLFVIEP Sbjct: 275 KLMNEIEADQSGTIVEILVEDGKSVSVDMPLFVIEP 310 >ref|XP_007029252.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), putative isoform 1 [Theobroma cacao] gi|508717857|gb|EOY09754.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), putative isoform 1 [Theobroma cacao] Length = 279 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 216 KLMNEIEADQSGTIVEVLVDDGKPVSVDMPLFVIEP 109 KLMNEIEADQSGTIVE+LV+DGK VSVDMPLFVIEP Sbjct: 244 KLMNEIEADQSGTIVEILVEDGKSVSVDMPLFVIEP 279 >gb|ABK26424.1| unknown [Picea sitchensis] Length = 309 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = -1 Query: 216 KLMNEIEADQSGTIVEVLVDDGKPVSVDMPLFVIEP 109 KLMNEIEAD+SGTIVE+LV+DGKPV+VDMPLFVI+P Sbjct: 274 KLMNEIEADRSGTIVEILVEDGKPVAVDMPLFVIKP 309 >gb|ADN52613.1| acetyl-CoA carboxylase BCCP subunit [Jatropha curcas] Length = 285 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 216 KLMNEIEADQSGTIVEVLVDDGKPVSVDMPLFVIEP 109 KLMNEIEADQSGTIVE+L +DGK VSVDMPLFVIEP Sbjct: 250 KLMNEIEADQSGTIVEILAEDGKSVSVDMPLFVIEP 285 >ref|XP_002514825.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1) [Ricinus communis] gi|223545876|gb|EEF47379.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1) [Ricinus communis] Length = 315 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 216 KLMNEIEADQSGTIVEVLVDDGKPVSVDMPLFVIEP 109 KLMNEIEADQSGTIVE L++DGKPVSVD PLFVIEP Sbjct: 280 KLMNEIEADQSGTIVEALLEDGKPVSVDTPLFVIEP 315 >gb|AFS89700.1| biotin carboxyl carrier protein [Vernicia fordii] Length = 252 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 216 KLMNEIEADQSGTIVEVLVDDGKPVSVDMPLFVIEP 109 KLMNEIEADQSGTI E+LV+DGKPVSVD+PLFVI P Sbjct: 217 KLMNEIEADQSGTIAEILVEDGKPVSVDLPLFVIAP 252 >gb|AGH32912.1| biotin carboxyl carrier protein subunit [Camellia chekiangoleosa] Length = 283 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -1 Query: 216 KLMNEIEADQSGTIVEVLVDDGKPVSVDMPLFVIEP 109 KLMNEIEADQSGT+VE++ +DGKPVSVD PLFVIEP Sbjct: 248 KLMNEIEADQSGTVVEIIAEDGKPVSVDTPLFVIEP 283 >gb|AFP99173.1| biotin carboxyl carrier protein [Vernicia fordii] Length = 270 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 216 KLMNEIEADQSGTIVEVLVDDGKPVSVDMPLFVIEP 109 KLMNEIEADQSGTI E+LV+DGKPVSVD+PLFVI P Sbjct: 235 KLMNEIEADQSGTIAEILVEDGKPVSVDLPLFVIAP 270 >gb|ACT33948.1| biotin carboxyl carrier protein subunit [Jatropha curcas] Length = 270 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 216 KLMNEIEADQSGTIVEVLVDDGKPVSVDMPLFVIEP 109 KLMNEIEADQ+GTI E+LV+DGKPVSVDMPLFVI P Sbjct: 235 KLMNEIEADQAGTIAEILVEDGKPVSVDMPLFVIAP 270 >ref|XP_004489456.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like isoform X2 [Cicer arietinum] Length = 282 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -1 Query: 216 KLMNEIEADQSGTIVEVLVDDGKPVSVDMPLFVIEP 109 KLMNEIEADQSGTI E+LV+DGKPVS+D+PLFVI P Sbjct: 247 KLMNEIEADQSGTITEILVEDGKPVSIDLPLFVIAP 282 >ref|XP_004489455.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like isoform X1 [Cicer arietinum] Length = 311 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -1 Query: 216 KLMNEIEADQSGTIVEVLVDDGKPVSVDMPLFVIEP 109 KLMNEIEADQSGTI E+LV+DGKPVS+D+PLFVI P Sbjct: 276 KLMNEIEADQSGTITEILVEDGKPVSIDLPLFVIAP 311 >ref|NP_001241523.1| uncharacterized protein LOC100777962 [Glycine max] gi|255645677|gb|ACU23332.1| unknown [Glycine max] Length = 280 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -1 Query: 216 KLMNEIEADQSGTIVEVLVDDGKPVSVDMPLFVIEP 109 KLMNEIEADQSGTI EVL +DGKPVSVDMPLFVI P Sbjct: 245 KLMNEIEADQSGTIAEVLAEDGKPVSVDMPLFVIVP 280 >ref|XP_003618716.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase [Medicago truncatula] gi|355493731|gb|AES74934.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase [Medicago truncatula] Length = 278 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 216 KLMNEIEADQSGTIVEVLVDDGKPVSVDMPLFVIEP 109 KLMNEIEADQSGTI E+LV+DGKPVSVD+PLFVI P Sbjct: 243 KLMNEIEADQSGTIAEILVEDGKPVSVDLPLFVIVP 278 >gb|EPS63946.1| hypothetical protein M569_10835 [Genlisea aurea] Length = 273 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -1 Query: 216 KLMNEIEADQSGTIVEVLVDDGKPVSVDMPLFVIEP 109 KLMNEIEADQSGTIVE+ +DGKPVSVDMPLF IEP Sbjct: 238 KLMNEIEADQSGTIVEIHAEDGKPVSVDMPLFTIEP 273 >ref|XP_004489502.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic-like [Cicer arietinum] Length = 285 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 216 KLMNEIEADQSGTIVEVLVDDGKPVSVDMPLFVIEP 109 KLMNEIEADQSGTI E+LV+DGKPVS+DMPLF I P Sbjct: 250 KLMNEIEADQSGTITEILVEDGKPVSIDMPLFAIAP 285 >gb|ABU41516.1| biotin carboxyl carrier protein subunit [Gossypium hirsutum] Length = 282 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 216 KLMNEIEADQSGTIVEVLVDDGKPVSVDMPLFVIEP 109 KLMNEIEADQSGT+VE+L +DGK VSVDMPLFVIEP Sbjct: 247 KLMNEIEADQSGTMVEILAEDGKAVSVDMPLFVIEP 282 >gb|EYU39717.1| hypothetical protein MIMGU_mgv1a011080mg [Mimulus guttatus] gi|604335830|gb|EYU39718.1| hypothetical protein MIMGU_mgv1a011080mg [Mimulus guttatus] Length = 293 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -1 Query: 216 KLMNEIEADQSGTIVEVLVDDGKPVSVDMPLFVIEP 109 KLMNEIEADQSGT+VE+L +DGKPVS+D PLFVIEP Sbjct: 258 KLMNEIEADQSGTLVEILGEDGKPVSIDTPLFVIEP 293