BLASTX nr result
ID: Paeonia24_contig00031129
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00031129 (277 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC35018.1| putative E3 ubiquitin-protein ligase MARCH10 [Mor... 61 1e-07 ref|XP_007215527.1| hypothetical protein PRUPE_ppa003767mg [Prun... 61 2e-07 >gb|EXC35018.1| putative E3 ubiquitin-protein ligase MARCH10 [Morus notabilis] Length = 497 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/49 (63%), Positives = 37/49 (75%) Frame = +1 Query: 130 MEDSGVQLQHTEESTSDSSGSFQACNDNAKTEESTLVQQSRRPNLSSLQ 276 ME+SG QLQ EES++DS+ Q CN+ K E + LVQQSRRPNLSSLQ Sbjct: 1 MENSGAQLQPLEESSADSTLQSQTCNEERKCEGTLLVQQSRRPNLSSLQ 49 >ref|XP_007215527.1| hypothetical protein PRUPE_ppa003767mg [Prunus persica] gi|462411677|gb|EMJ16726.1| hypothetical protein PRUPE_ppa003767mg [Prunus persica] Length = 550 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = +1 Query: 127 LMEDSGVQLQHTEESTSDSSGSFQACNDNAKTEESTLVQQSRRPNLSSLQ 276 +ME S +LQH EESTSD+S Q + K EE++LVQQSRRPNLSSLQ Sbjct: 1 MMESSASELQHGEESTSDASDQPQVHDQQGKNEETSLVQQSRRPNLSSLQ 50