BLASTX nr result
ID: Paeonia24_contig00031103
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00031103 (473 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004287591.1| PREDICTED: pentatricopeptide repeat-containi... 77 2e-12 ref|XP_006472181.1| PREDICTED: pentatricopeptide repeat-containi... 76 4e-12 ref|XP_006433515.1| hypothetical protein CICLE_v10004048mg [Citr... 76 4e-12 ref|XP_007202016.1| hypothetical protein PRUPE_ppa004939mg [Prun... 76 4e-12 gb|EXC13338.1| hypothetical protein L484_012766 [Morus notabilis] 73 4e-11 ref|XP_007031128.1| Tetratricopeptide repeat (TPR)-like superfam... 73 4e-11 emb|CBI39579.3| unnamed protein product [Vitis vinifera] 72 6e-11 ref|XP_002278152.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 ref|XP_003535324.1| PREDICTED: pentatricopeptide repeat-containi... 72 8e-11 ref|XP_004230293.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 ref|XP_007144992.1| hypothetical protein PHAVU_007G200500g [Phas... 70 2e-10 ref|XP_006344748.1| PREDICTED: pentatricopeptide repeat-containi... 69 5e-10 ref|XP_004495670.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 ref|XP_007207048.1| hypothetical protein PRUPE_ppb025182mg [Prun... 68 1e-09 ref|XP_004144815.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 ref|XP_006303773.1| hypothetical protein CARUB_v10012008mg [Caps... 67 3e-09 ref|XP_004308755.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 ref|NP_172391.2| pentatricopeptide repeat-containing protein [Ar... 67 3e-09 ref|XP_006417598.1| hypothetical protein EUTSA_v10009682mg, part... 67 3e-09 ref|XP_007216989.1| hypothetical protein PRUPE_ppa002640mg [Prun... 67 3e-09 >ref|XP_004287591.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09190-like [Fragaria vesca subsp. vesca] Length = 487 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/45 (82%), Positives = 38/45 (84%) Frame = +3 Query: 3 EPCNSGNYVLLSNIYAEGGRWDEVEKVRMLMKENSVKKAPGHSGI 137 EP NSGNYVLLSNIYAE GRWDEVEKVR LMKEN + KAPG S I Sbjct: 440 EPWNSGNYVLLSNIYAEEGRWDEVEKVRELMKENCITKAPGQSAI 484 >ref|XP_006472181.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09190-like [Citrus sinensis] Length = 484 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = +3 Query: 3 EPCNSGNYVLLSNIYAEGGRWDEVEKVRMLMKENSVKKAPGHSGIE 140 EP NSGNYVLLSNIYAEGGRWD+ EK+RM M+E +VKK+PG S IE Sbjct: 439 EPWNSGNYVLLSNIYAEGGRWDDAEKLRMWMREKNVKKSPGQSLIE 484 >ref|XP_006433515.1| hypothetical protein CICLE_v10004048mg [Citrus clementina] gi|557535637|gb|ESR46755.1| hypothetical protein CICLE_v10004048mg [Citrus clementina] Length = 484 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = +3 Query: 3 EPCNSGNYVLLSNIYAEGGRWDEVEKVRMLMKENSVKKAPGHSGIE 140 EP NSGNYVLLSNIYAEGGRWD+ E +RM M+EN+VKK+PG S IE Sbjct: 439 EPWNSGNYVLLSNIYAEGGRWDDAETLRMWMRENNVKKSPGQSLIE 484 >ref|XP_007202016.1| hypothetical protein PRUPE_ppa004939mg [Prunus persica] gi|462397547|gb|EMJ03215.1| hypothetical protein PRUPE_ppa004939mg [Prunus persica] Length = 484 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/45 (80%), Positives = 38/45 (84%) Frame = +3 Query: 3 EPCNSGNYVLLSNIYAEGGRWDEVEKVRMLMKENSVKKAPGHSGI 137 EP NSGNYVLLSNIYAE GRWDEVEKVR LM+EN +KK PG S I Sbjct: 439 EPRNSGNYVLLSNIYAEEGRWDEVEKVRDLMRENCIKKTPGQSAI 483 >gb|EXC13338.1| hypothetical protein L484_012766 [Morus notabilis] Length = 486 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = +3 Query: 3 EPCNSGNYVLLSNIYAEGGRWDEVEKVRMLMKENSVKKAPGHSGI 137 EPCNSGNY+LLSN+YAE GRW++VEKVR LMKE VKKA G S + Sbjct: 439 EPCNSGNYILLSNMYAEEGRWNKVEKVRDLMKEKCVKKASGQSSV 483 >ref|XP_007031128.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508719733|gb|EOY11630.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 484 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +3 Query: 3 EPCNSGNYVLLSNIYAEGGRWDEVEKVRMLMKENSVKKAPGHS 131 EP NSGNYVLLSNIYAE GRWDEV+K+R+LM+E SVKKA G S Sbjct: 439 EPWNSGNYVLLSNIYAEEGRWDEVDKIRVLMREKSVKKAMGQS 481 >emb|CBI39579.3| unnamed protein product [Vitis vinifera] Length = 459 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +3 Query: 3 EPCNSGNYVLLSNIYAEGGRWDEVEKVRMLMKENSVKKAPGHS 131 EP NSGNYVLLSN+YAE G+WDEVEKVR LMKE +++K PG S Sbjct: 413 EPWNSGNYVLLSNVYAEDGKWDEVEKVRALMKEKNIRKNPGQS 455 >ref|XP_002278152.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09190 [Vitis vinifera] Length = 485 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +3 Query: 3 EPCNSGNYVLLSNIYAEGGRWDEVEKVRMLMKENSVKKAPGHS 131 EP NSGNYVLLSN+YAE G+WDEVEKVR LMKE +++K PG S Sbjct: 439 EPWNSGNYVLLSNVYAEDGKWDEVEKVRALMKEKNIRKNPGQS 481 >ref|XP_003535324.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09190-like [Glycine max] Length = 483 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = +3 Query: 3 EPCNSGNYVLLSNIYAEGGRWDEVEKVRMLMKENSVKKAPGHS 131 EP NSGNYVLLSN+YAE GRWDEVEKVR+LM+ VKK PG S Sbjct: 438 EPWNSGNYVLLSNVYAEEGRWDEVEKVRVLMRGGGVKKVPGQS 480 >ref|XP_004230293.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09190-like [Solanum lycopersicum] Length = 484 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +3 Query: 3 EPCNSGNYVLLSNIYAEGGRWDEVEKVRMLMKENSVKKAPGHS 131 EP NSGNYVLLSNIYA+ G+W++VEKVR+LM NS+KKAPG S Sbjct: 439 EPWNSGNYVLLSNIYADRGKWEDVEKVRVLMSGNSIKKAPGQS 481 >ref|XP_007144992.1| hypothetical protein PHAVU_007G200500g [Phaseolus vulgaris] gi|561018182|gb|ESW16986.1| hypothetical protein PHAVU_007G200500g [Phaseolus vulgaris] Length = 479 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/43 (76%), Positives = 35/43 (81%) Frame = +3 Query: 3 EPCNSGNYVLLSNIYAEGGRWDEVEKVRMLMKENSVKKAPGHS 131 EP NSGNYVLLSNIYAE GRWDEVEKVR+LM+ V K PG S Sbjct: 434 EPWNSGNYVLLSNIYAEEGRWDEVEKVRVLMRGGGVNKVPGQS 476 >ref|XP_006344748.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09190-like [Solanum tuberosum] Length = 484 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = +3 Query: 3 EPCNSGNYVLLSNIYAEGGRWDEVEKVRMLMKENSVKKAPGHSGI 137 E NSGNYVLLSNIYA+ G+W++VEKVR+LM NS+KKAPG S I Sbjct: 439 ESWNSGNYVLLSNIYADRGKWEDVEKVRVLMSGNSIKKAPGQSTI 483 >ref|XP_004495670.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09190-like [Cicer arietinum] Length = 485 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +3 Query: 3 EPCNSGNYVLLSNIYAEGGRWDEVEKVRMLMKENSVKKAPGHS 131 EP NSGNYVLLSN+YAE G+WDEVEKVR+ M+ VKK PG S Sbjct: 440 EPWNSGNYVLLSNVYAEEGKWDEVEKVRVSMQGGGVKKIPGQS 482 >ref|XP_007207048.1| hypothetical protein PRUPE_ppb025182mg [Prunus persica] gi|462402690|gb|EMJ08247.1| hypothetical protein PRUPE_ppb025182mg [Prunus persica] Length = 672 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/46 (67%), Positives = 36/46 (78%) Frame = +3 Query: 3 EPCNSGNYVLLSNIYAEGGRWDEVEKVRMLMKENSVKKAPGHSGIE 140 EP NSG Y LLSNIYA+ GRWD+ EKVRMLMKE VK +PG S ++ Sbjct: 499 EPQNSGRYALLSNIYAKAGRWDDAEKVRMLMKERGVKTSPGISMVD 544 >ref|XP_004144815.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09190-like [Cucumis sativus] gi|449490933|ref|XP_004158752.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09190-like [Cucumis sativus] Length = 484 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = +3 Query: 3 EPCNSGNYVLLSNIYAEGGRWDEVEKVRMLMKENSVKKAPGHS 131 EP NSGNYVLLSN+ AE GRW+EVE VR M+E SVKKAPG S Sbjct: 439 EPWNSGNYVLLSNMLAEEGRWEEVENVRQWMREKSVKKAPGQS 481 >ref|XP_006303773.1| hypothetical protein CARUB_v10012008mg [Capsella rubella] gi|482572484|gb|EOA36671.1| hypothetical protein CARUB_v10012008mg [Capsella rubella] Length = 484 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = +3 Query: 3 EPCNSGNYVLLSNIYAEGGRWDEVEKVRMLMKENSVKKAPGHSGI 137 EP NSGNYVLLSN+YAE GRW +VEKVR LMK+N ++K+ G S I Sbjct: 435 EPGNSGNYVLLSNLYAEEGRWQDVEKVRTLMKKNRLRKSTGQSTI 479 >ref|XP_004308755.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Fragaria vesca subsp. vesca] Length = 631 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/46 (67%), Positives = 37/46 (80%) Frame = +3 Query: 3 EPCNSGNYVLLSNIYAEGGRWDEVEKVRMLMKENSVKKAPGHSGIE 140 EP NSGNYVLLSNIYAE G W EV+K+R+L+K +KK+PG S IE Sbjct: 396 EPDNSGNYVLLSNIYAEAGMWKEVDKLRILLKSQGMKKSPGCSWIE 441 >ref|NP_172391.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75099767|sp|O80488.1|PPR23_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g09190 gi|3249103|gb|AAC24086.1| Contains similarity to membrane-associated salt-inducible protein homolog TM021B04.10 gb|2191192 from A. thaliana BAC gb|AF007271 [Arabidopsis thaliana] gi|28393182|gb|AAO42022.1| unknown protein [Arabidopsis thaliana] gi|332190289|gb|AEE28410.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 484 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = +3 Query: 3 EPCNSGNYVLLSNIYAEGGRWDEVEKVRMLMKENSVKKAPGHSGI 137 EP NSGNYVLLSN+YAE GRW +VEKVR LMK+N ++K+ G S I Sbjct: 435 EPGNSGNYVLLSNLYAEEGRWQDVEKVRTLMKKNRLRKSTGQSTI 479 >ref|XP_006417598.1| hypothetical protein EUTSA_v10009682mg, partial [Eutrema salsugineum] gi|557095369|gb|ESQ35951.1| hypothetical protein EUTSA_v10009682mg, partial [Eutrema salsugineum] Length = 483 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = +3 Query: 3 EPCNSGNYVLLSNIYAEGGRWDEVEKVRMLMKENSVKKAPGHSGI 137 EP NSGNYVLLSN+YAE GRW++VEKVR +MK+ S++K+ G S I Sbjct: 435 EPGNSGNYVLLSNLYAEEGRWEDVEKVRAMMKKKSLRKSTGQSTI 479 >ref|XP_007216989.1| hypothetical protein PRUPE_ppa002640mg [Prunus persica] gi|462413139|gb|EMJ18188.1| hypothetical protein PRUPE_ppa002640mg [Prunus persica] Length = 649 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/46 (67%), Positives = 39/46 (84%) Frame = +3 Query: 3 EPCNSGNYVLLSNIYAEGGRWDEVEKVRMLMKENSVKKAPGHSGIE 140 EP + NYVLLSN++AE GRWD+VEKVR+LMKE+S++K PG S IE Sbjct: 576 EPDKASNYVLLSNMHAEAGRWDKVEKVRVLMKESSMEKQPGCSWIE 621