BLASTX nr result
ID: Paeonia24_contig00031040
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00031040 (352 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515891.1| hypothetical protein RCOM_1485780 [Ricinus c... 90 3e-16 ref|XP_006466067.1| PREDICTED: putative F-box/LRR-repeat protein... 86 4e-15 ref|XP_006466063.1| PREDICTED: putative F-box/LRR-repeat protein... 86 4e-15 ref|XP_006466062.1| PREDICTED: putative F-box/LRR-repeat protein... 86 4e-15 ref|XP_006426492.1| hypothetical protein CICLE_v10025281mg [Citr... 85 9e-15 ref|XP_006466066.1| PREDICTED: putative F-box protein At1g49610-... 85 1e-14 ref|XP_006426497.1| hypothetical protein CICLE_v10025282mg [Citr... 85 1e-14 ref|XP_003638633.1| F-box/LRR-repeat protein [Medicago truncatul... 83 4e-14 ref|XP_003638606.1| hypothetical protein MTR_138s0006, partial [... 83 4e-14 ref|XP_004146859.1| PREDICTED: putative F-box/FBD/LRR-repeat pro... 82 6e-14 ref|XP_003638639.1| Serine/threonine protein phosphatase 2A 55 k... 82 1e-13 ref|XP_003638638.1| Serine/threonine protein phosphatase 2A 55 k... 82 1e-13 ref|XP_003618258.1| FBD-associated F-box protein [Medicago trunc... 82 1e-13 ref|XP_006465007.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 81 1e-13 ref|XP_006432200.1| hypothetical protein CICLE_v10000694mg [Citr... 81 1e-13 ref|XP_006432199.1| hypothetical protein CICLE_v10000694mg [Citr... 81 1e-13 ref|XP_004154877.1| PREDICTED: putative F-box/FBD/LRR-repeat pro... 81 2e-13 ref|XP_003621965.1| F-box/LRR-repeat protein [Medicago truncatul... 81 2e-13 ref|XP_006585532.1| PREDICTED: FBD-associated F-box protein At5g... 80 3e-13 ref|XP_003627163.1| F-box/FBD/LRR-repeat protein [Medicago trunc... 79 7e-13 >ref|XP_002515891.1| hypothetical protein RCOM_1485780 [Ricinus communis] gi|223544796|gb|EEF46311.1| hypothetical protein RCOM_1485780 [Ricinus communis] Length = 514 Score = 90.1 bits (222), Expect = 3e-16 Identities = 46/106 (43%), Positives = 69/106 (65%), Gaps = 1/106 (0%) Frame = -1 Query: 331 EINISACKNLTSLNLSSGATVTEEWFYDLSTKFPFLASLSLISCNMLKRINISSHFLKRL 152 +IN++ CK+L SL L A ++++WF +L + F + L L CN L+ I IS +LK+L Sbjct: 68 KINLAMCKDLKSLTLED-ANMSDDWFQNLLSNFSLIEQLILSKCNALRHITISGRWLKKL 126 Query: 151 VMIDLRDLVEVHIDAPNLLSFRYKGHLISFSSYLP-SLLKAELYLD 17 +++ R+L E ID PNLLSF Y+G + FSS P SL +A+LY + Sbjct: 127 ALMECRELTEADIDTPNLLSFEYRGQKMPFSSLNPFSLKEAKLYFE 172 >ref|XP_006466067.1| PREDICTED: putative F-box/LRR-repeat protein At4g00320-like [Citrus sinensis] Length = 566 Score = 86.3 bits (212), Expect = 4e-15 Identities = 46/107 (42%), Positives = 66/107 (61%) Frame = -1 Query: 337 PSEINISACKNLTSLNLSSGATVTEEWFYDLSTKFPFLASLSLISCNMLKRINISSHFLK 158 P EIN+++CKN+ L L ++ +EW FPFL +L+L+ C+ LK I ISS LK Sbjct: 286 PCEINVASCKNIKFLTLRL-LSLKDEWLCSQIPNFPFLENLNLVGCDKLKSIKISSLSLK 344 Query: 157 RLVMIDLRDLVEVHIDAPNLLSFRYKGHLISFSSYLPSLLKAELYLD 17 L + + L+EV I+APNL FRY+G ++SFS +LL+ L D Sbjct: 345 TLKIFECAGLIEVKIEAPNLSIFRYEGDVVSFSIGAMTLLETHLNFD 391 >ref|XP_006466063.1| PREDICTED: putative F-box/LRR-repeat protein At4g00320-like [Citrus sinensis] Length = 566 Score = 86.3 bits (212), Expect = 4e-15 Identities = 46/107 (42%), Positives = 66/107 (61%) Frame = -1 Query: 337 PSEINISACKNLTSLNLSSGATVTEEWFYDLSTKFPFLASLSLISCNMLKRINISSHFLK 158 P EIN+++CKN+ L L ++ +EW FPFL +L+L+ C+ LK I ISS LK Sbjct: 286 PCEINVASCKNIKFLTLRL-LSLKDEWLCSQIPNFPFLENLNLVGCDKLKSIKISSLSLK 344 Query: 157 RLVMIDLRDLVEVHIDAPNLLSFRYKGHLISFSSYLPSLLKAELYLD 17 L + + L+EV I+APNL FRY+G ++SFS +LL+ L D Sbjct: 345 TLKIFECAGLIEVKIEAPNLSIFRYEGDVVSFSIGAMTLLETHLNFD 391 >ref|XP_006466062.1| PREDICTED: putative F-box/LRR-repeat protein At4g00320-like [Citrus sinensis] Length = 566 Score = 86.3 bits (212), Expect = 4e-15 Identities = 46/107 (42%), Positives = 66/107 (61%) Frame = -1 Query: 337 PSEINISACKNLTSLNLSSGATVTEEWFYDLSTKFPFLASLSLISCNMLKRINISSHFLK 158 P EIN+++CKN+ L L ++ +EW FPFL +L+L+ C+ LK I ISS LK Sbjct: 286 PCEINVASCKNIKFLTLRL-LSLKDEWLCSQIPNFPFLENLNLVGCDKLKSIKISSLSLK 344 Query: 157 RLVMIDLRDLVEVHIDAPNLLSFRYKGHLISFSSYLPSLLKAELYLD 17 L + + L+EV I+APNL FRY+G ++SFS +LL+ L D Sbjct: 345 TLKIFECAGLIEVKIEAPNLSIFRYEGDVVSFSIGAMTLLETHLNFD 391 >ref|XP_006426492.1| hypothetical protein CICLE_v10025281mg [Citrus clementina] gi|557528482|gb|ESR39732.1| hypothetical protein CICLE_v10025281mg [Citrus clementina] Length = 566 Score = 85.1 bits (209), Expect = 9e-15 Identities = 45/107 (42%), Positives = 66/107 (61%) Frame = -1 Query: 337 PSEINISACKNLTSLNLSSGATVTEEWFYDLSTKFPFLASLSLISCNMLKRINISSHFLK 158 P +IN+++CKN+ L L ++ +EW FPFL +L+L+ C+ LK I ISS LK Sbjct: 286 PCDINVASCKNIKFLTLRL-LSLKDEWLCSQIPNFPFLENLNLVGCDKLKSIKISSLSLK 344 Query: 157 RLVMIDLRDLVEVHIDAPNLLSFRYKGHLISFSSYLPSLLKAELYLD 17 L + + L+EV I+APNL FRY+G ++SFS +LL+ L D Sbjct: 345 TLKIFECAGLIEVKIEAPNLSIFRYEGDVVSFSIGAMTLLETHLSFD 391 >ref|XP_006466066.1| PREDICTED: putative F-box protein At1g49610-like [Citrus sinensis] Length = 566 Score = 84.7 bits (208), Expect = 1e-14 Identities = 45/104 (43%), Positives = 65/104 (62%) Frame = -1 Query: 337 PSEINISACKNLTSLNLSSGATVTEEWFYDLSTKFPFLASLSLISCNMLKRINISSHFLK 158 P EIN+++CKN+ L L ++ +EW FPFL +L+L+ C+ LK I ISS LK Sbjct: 286 PCEINVASCKNIKFLTLRL-LSLKDEWLCSQIPNFPFLENLNLVGCDKLKSIKISSLSLK 344 Query: 157 RLVMIDLRDLVEVHIDAPNLLSFRYKGHLISFSSYLPSLLKAEL 26 L + + L+EV I+APNL FRY+G ++SFS +LL+ L Sbjct: 345 MLKIFECAGLIEVKIEAPNLSIFRYQGDVVSFSIGAMTLLETHL 388 >ref|XP_006426497.1| hypothetical protein CICLE_v10025282mg [Citrus clementina] gi|557528487|gb|ESR39737.1| hypothetical protein CICLE_v10025282mg [Citrus clementina] Length = 566 Score = 84.7 bits (208), Expect = 1e-14 Identities = 45/104 (43%), Positives = 65/104 (62%) Frame = -1 Query: 337 PSEINISACKNLTSLNLSSGATVTEEWFYDLSTKFPFLASLSLISCNMLKRINISSHFLK 158 P EIN+++CKN+ L L ++ +EW FPFL +L+L+ C+ LK I ISS LK Sbjct: 286 PCEINVASCKNIKFLTLRL-LSLKDEWLCSQIPNFPFLENLNLVGCDKLKSIKISSLSLK 344 Query: 157 RLVMIDLRDLVEVHIDAPNLLSFRYKGHLISFSSYLPSLLKAEL 26 L + + L+EV I+APNL FRY+G ++SFS +LL+ L Sbjct: 345 MLKIFECAGLIEVKIEAPNLSIFRYQGDVVSFSIGAMTLLETHL 388 >ref|XP_003638633.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355504568|gb|AES85771.1| F-box/LRR-repeat protein [Medicago truncatula] Length = 545 Score = 83.2 bits (204), Expect = 4e-14 Identities = 51/114 (44%), Positives = 70/114 (61%), Gaps = 4/114 (3%) Frame = -1 Query: 340 SPSEINISACKNLTSLNLSS--GATVTEEWFYDLSTKFPFLASLSLISCNMLKRINISSH 167 +P +I+ CKNL LNL S +T++WF +L KFPFL SL L +C M ++INISS Sbjct: 271 APFKIDFERCKNLKKLNLLSLMSIIITDKWFLELFPKFPFLESLKLDNCTMSEKINISSV 330 Query: 166 FLKRLVMIDLRDLVEVHIDAPNLLSFRYKGHLIS--FSSYLPSLLKAELYLDLP 11 LK L + D +L EV+IDAPNLL Y G S S+L S + ++ +D+P Sbjct: 331 QLKVLELFDCSNLKEVNIDAPNLLLCVYCGVGSSEPIISFLRSSSQLKVNIDIP 384 >ref|XP_003638606.1| hypothetical protein MTR_138s0006, partial [Medicago truncatula] gi|355504541|gb|AES85744.1| hypothetical protein MTR_138s0006, partial [Medicago truncatula] Length = 373 Score = 83.2 bits (204), Expect = 4e-14 Identities = 51/114 (44%), Positives = 70/114 (61%), Gaps = 4/114 (3%) Frame = -1 Query: 340 SPSEINISACKNLTSLNLSS--GATVTEEWFYDLSTKFPFLASLSLISCNMLKRINISSH 167 +P +I+ CKNL LNL S +T++WF +L KFPFL SL L +C M ++INISS Sbjct: 140 APFKIDFERCKNLKKLNLLSLMSIIITDKWFLELFPKFPFLESLKLDNCTMSEKINISSV 199 Query: 166 FLKRLVMIDLRDLVEVHIDAPNLLSFRYKGHLIS--FSSYLPSLLKAELYLDLP 11 LK L + D +L EV+IDAPNLL Y G S S+L S + ++ +D+P Sbjct: 200 QLKVLELFDCSNLKEVNIDAPNLLLCVYCGVGSSEPIISFLRSSSQLKVNIDIP 253 >ref|XP_004146859.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At1g78840-like [Cucumis sativus] Length = 469 Score = 82.4 bits (202), Expect = 6e-14 Identities = 45/110 (40%), Positives = 66/110 (60%) Frame = -1 Query: 349 GSRSPSEINISACKNLTSLNLSSGATVTEEWFYDLSTKFPFLASLSLISCNMLKRINISS 170 G P INIS+CKNL +L LS A +T++WF ++FP L L+L C+ML+ + ISS Sbjct: 232 GQFQPCCINISSCKNLKTLKLSMVA-ITDDWFNRCFSEFPLLEILALSYCHMLESLRISS 290 Query: 169 HFLKRLVMIDLRDLVEVHIDAPNLLSFRYKGHLISFSSYLPSLLKAELYL 20 LK+ ++ + V IDAP L + G +ISFS P+L +A++ L Sbjct: 291 SHLKKFILCGCESVTRVDIDAPCLSGLEFSGDVISFSLNAPALSQADIEL 340 >ref|XP_003638639.1| Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform [Medicago truncatula] gi|355504574|gb|AES85777.1| Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform [Medicago truncatula] Length = 654 Score = 81.6 bits (200), Expect = 1e-13 Identities = 51/116 (43%), Positives = 72/116 (62%), Gaps = 4/116 (3%) Frame = -1 Query: 340 SPSEINISACKNLTSLNLSS--GATVTEEWFYDLSTKFPFLASLSLISCNMLKRINISSH 167 +P +I+ C+NL L+L S + +T++WF +L +KFPFL SL L +C M +RINISS Sbjct: 380 APFKIDFDRCQNLKYLDLLSLKSSIITDKWFLELFSKFPFLESLKLNNCRMFERINISSV 439 Query: 166 FLKRLVMIDLRDLVEVHIDAPNLLS--FRYKGHLISFSSYLPSLLKAELYLDLPKD 5 LK L + + +L EV+IDAPNLLS F G S+L S + E+ L +P D Sbjct: 440 QLKVLELSNCSNLKEVNIDAPNLLSCVFYGGGGSEPIISFLRSSSQLEVDLQIPID 495 >ref|XP_003638638.1| Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform [Medicago truncatula] gi|355504573|gb|AES85776.1| Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform [Medicago truncatula] Length = 652 Score = 81.6 bits (200), Expect = 1e-13 Identities = 51/116 (43%), Positives = 72/116 (62%), Gaps = 4/116 (3%) Frame = -1 Query: 340 SPSEINISACKNLTSLNLSS--GATVTEEWFYDLSTKFPFLASLSLISCNMLKRINISSH 167 +P +I+ C+NL L+L S + +T++WF +L +KFPFL SL L +C M +RINISS Sbjct: 378 APFKIDFDRCQNLKYLDLLSLKSSIITDKWFLELFSKFPFLESLKLNNCRMFERINISSV 437 Query: 166 FLKRLVMIDLRDLVEVHIDAPNLLS--FRYKGHLISFSSYLPSLLKAELYLDLPKD 5 LK L + + +L EV+IDAPNLLS F G S+L S + E+ L +P D Sbjct: 438 QLKVLELSNCSNLKEVNIDAPNLLSCVFYGGGGSEPIISFLRSSSQLEVDLQIPID 493 >ref|XP_003618258.1| FBD-associated F-box protein [Medicago truncatula] gi|355493273|gb|AES74476.1| FBD-associated F-box protein [Medicago truncatula] Length = 519 Score = 81.6 bits (200), Expect = 1e-13 Identities = 44/89 (49%), Positives = 60/89 (67%), Gaps = 1/89 (1%) Frame = -1 Query: 340 SPSEINISACKNLTSLNL-SSGATVTEEWFYDLSTKFPFLASLSLISCNMLKRINISSHF 164 +PS+I+ C+NL L L S +T T +WF +L KFPFL SL L +C M K+I+ISS Sbjct: 265 APSKIDFDRCRNLKELYLWSVESTSTNKWFLELFPKFPFLESLKLNNCKMPKKIDISSVR 324 Query: 163 LKRLVMIDLRDLVEVHIDAPNLLSFRYKG 77 LKRL + +L E++ID+PNL+SF Y G Sbjct: 325 LKRLEFMHSSNLKELNIDSPNLISFGYSG 353 >ref|XP_006465007.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Citrus sinensis] Length = 536 Score = 81.3 bits (199), Expect = 1e-13 Identities = 43/94 (45%), Positives = 60/94 (63%) Frame = -1 Query: 337 PSEINISACKNLTSLNLSSGATVTEEWFYDLSTKFPFLASLSLISCNMLKRINISSHFLK 158 P E+N+S+CKNLT L L G ++T++W Y+ ++ PFL L+L C L+ INISS LK Sbjct: 246 PCEVNVSSCKNLTHLRLD-GLSITDKWLYNQISELPFLEYLALHYCMKLRSINISSPRLK 304 Query: 157 RLVMIDLRDLVEVHIDAPNLLSFRYKGHLISFSS 56 LV +LVE +D PNL F+ ++ SFSS Sbjct: 305 ELVFERCEELVEFELDTPNLSIFKCFNYVESFSS 338 >ref|XP_006432200.1| hypothetical protein CICLE_v10000694mg [Citrus clementina] gi|557534322|gb|ESR45440.1| hypothetical protein CICLE_v10000694mg [Citrus clementina] Length = 578 Score = 81.3 bits (199), Expect = 1e-13 Identities = 43/94 (45%), Positives = 60/94 (63%) Frame = -1 Query: 337 PSEINISACKNLTSLNLSSGATVTEEWFYDLSTKFPFLASLSLISCNMLKRINISSHFLK 158 P E+N+S+CKNLT L L G ++T++W Y+ ++ PFL L+L C L+ INISS LK Sbjct: 288 PCEVNVSSCKNLTHLRLD-GLSITDKWLYNQISELPFLEYLALHYCMKLRSINISSPRLK 346 Query: 157 RLVMIDLRDLVEVHIDAPNLLSFRYKGHLISFSS 56 LV +LVE +D PNL F+ ++ SFSS Sbjct: 347 ELVFERCEELVEFELDTPNLSIFKCFNYVESFSS 380 >ref|XP_006432199.1| hypothetical protein CICLE_v10000694mg [Citrus clementina] gi|557534321|gb|ESR45439.1| hypothetical protein CICLE_v10000694mg [Citrus clementina] Length = 505 Score = 81.3 bits (199), Expect = 1e-13 Identities = 43/94 (45%), Positives = 60/94 (63%) Frame = -1 Query: 337 PSEINISACKNLTSLNLSSGATVTEEWFYDLSTKFPFLASLSLISCNMLKRINISSHFLK 158 P E+N+S+CKNLT L L G ++T++W Y+ ++ PFL L+L C L+ INISS LK Sbjct: 288 PCEVNVSSCKNLTHLRLD-GLSITDKWLYNQISELPFLEYLALHYCMKLRSINISSPRLK 346 Query: 157 RLVMIDLRDLVEVHIDAPNLLSFRYKGHLISFSS 56 LV +LVE +D PNL F+ ++ SFSS Sbjct: 347 ELVFERCEELVEFELDTPNLSIFKCFNYVESFSS 380 >ref|XP_004154877.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At1g78840-like [Cucumis sativus] Length = 469 Score = 80.9 bits (198), Expect = 2e-13 Identities = 44/110 (40%), Positives = 65/110 (59%) Frame = -1 Query: 349 GSRSPSEINISACKNLTSLNLSSGATVTEEWFYDLSTKFPFLASLSLISCNMLKRINISS 170 G P INIS+CKNL +L LS A +T++WF ++FP L L+L C+ML+ + ISS Sbjct: 232 GQFQPCCINISSCKNLKTLKLSMVA-ITDDWFNRCFSEFPLLEILALSYCHMLESLRISS 290 Query: 169 HFLKRLVMIDLRDLVEVHIDAPNLLSFRYKGHLISFSSYLPSLLKAELYL 20 LK+ ++ + V ID P L + G +ISFS P+L +A++ L Sbjct: 291 SHLKKFILCGCESVTRVDIDTPCLSGLEFSGDVISFSLNAPALSQADIEL 340 >ref|XP_003621965.1| F-box/LRR-repeat protein [Medicago truncatula] gi|357503387|ref|XP_003621982.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355496980|gb|AES78183.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355496997|gb|AES78200.1| F-box/LRR-repeat protein [Medicago truncatula] Length = 557 Score = 80.9 bits (198), Expect = 2e-13 Identities = 48/117 (41%), Positives = 70/117 (59%), Gaps = 9/117 (7%) Frame = -1 Query: 340 SPSEINISACKNLTSLNLSS--GATVTEEWFYDLSTKFPFLASLSLISCNMLKRINISSH 167 +P +I+ +C+NL L+L S G T+T++WF +L +KFPFL L + C M + INISS Sbjct: 281 APYKIHFDSCRNLKGLDLFSLEGNTITDKWFLELFSKFPFLERLKFVKCTMSETINISSV 340 Query: 166 FLKRLVMIDLRDLVEVHIDAPNLLSFRY---KGHLISFSSYLPSLLK----AELYLD 17 LK L + ++ EV+IDAPNLLS Y HL S++ S K ++Y+D Sbjct: 341 QLKVLELSGCHNMKEVNIDAPNLLSCEYIIDTQHLEPIISFVRSSSKLKVDVQIYID 397 >ref|XP_006585532.1| PREDICTED: FBD-associated F-box protein At5g60610-like [Glycine max] Length = 547 Score = 80.1 bits (196), Expect = 3e-13 Identities = 48/111 (43%), Positives = 66/111 (59%), Gaps = 2/111 (1%) Frame = -1 Query: 340 SPSEINISACKNLTSLNLSS--GATVTEEWFYDLSTKFPFLASLSLISCNMLKRINISSH 167 SP ++N C+NL L L S T+T++WF DL TKFPFL L ++C M + INISS Sbjct: 270 SPFKMNFDKCRNLRVLYLWSLKSTTITDKWFLDLFTKFPFLECLKFVNCTMSETINISSA 329 Query: 166 FLKRLVMIDLRDLVEVHIDAPNLLSFRYKGHLISFSSYLPSLLKAELYLDL 14 LK L + + L E+++DAPNLLS Y G S + S LK+ L++ Sbjct: 330 QLKVLELSNCSKLKELNLDAPNLLSCGYCGD--GASKPIISFLKSSSQLEV 378 >ref|XP_003627163.1| F-box/FBD/LRR-repeat protein [Medicago truncatula] gi|355521185|gb|AET01639.1| F-box/FBD/LRR-repeat protein [Medicago truncatula] Length = 600 Score = 79.0 bits (193), Expect = 7e-13 Identities = 49/115 (42%), Positives = 68/115 (59%), Gaps = 3/115 (2%) Frame = -1 Query: 340 SPSEINISACKNLTSLNLS-SGATVTEEWFYDLSTKFPFLASLSLISCNMLKRINISSHF 164 +P +I+ C+NL L+L +T++WF +L KF FL SL L C M +RINISS Sbjct: 270 APFKIDFDRCQNLKYLDLCLDSGIITDKWFLELFRKFRFLESLKLDDCTMAERINISSVQ 329 Query: 163 LKRLVMIDLRDLVEVHIDAPNLLSFRY--KGHLISFSSYLPSLLKAELYLDLPKD 5 LK L + D +L EV+IDAPNLLS Y G S+L S + ++ +D+P D Sbjct: 330 LKVLELSDCSNLKEVNIDAPNLLSCVYCSDGDSEPIISFLTSSSQLKVDMDIPID 384