BLASTX nr result
ID: Paeonia24_contig00031015
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00031015 (229 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006418099.1| hypothetical protein EUTSA_v10006811mg [Eutr... 59 9e-07 ref|XP_006367799.1| PREDICTED: nucleolar GTP-binding protein 1-l... 58 1e-06 ref|XP_007132018.1| hypothetical protein PHAVU_011G059700g [Phas... 58 1e-06 ref|XP_002299913.2| nucleolar GTP-binding protein 1 [Populus tri... 58 1e-06 ref|XP_004489044.1| PREDICTED: nucleolar GTP-binding protein 1-l... 58 1e-06 ref|XP_004243372.1| PREDICTED: nucleolar GTP-binding protein 1-l... 58 1e-06 ref|XP_004229516.1| PREDICTED: nucleolar GTP-binding protein 1-l... 58 1e-06 ref|XP_003627147.1| hypothetical protein MTR_8g018150 [Medicago ... 58 1e-06 gb|EXB93299.1| Nucleolar GTP-binding protein 1 [Morus notabilis] 58 2e-06 ref|XP_007029236.1| Nucleolar GTP-binding protein [Theobroma cac... 58 2e-06 ref|XP_004142938.1| PREDICTED: nucleolar GTP-binding protein 1-l... 58 2e-06 ref|XP_007210791.1| hypothetical protein PRUPE_ppa018546mg [Prun... 57 4e-06 ref|XP_007210301.1| hypothetical protein PRUPE_ppa002488mg [Prun... 57 4e-06 ref|XP_007206320.1| hypothetical protein PRUPE_ppa002518mg [Prun... 57 4e-06 ref|XP_006306939.1| hypothetical protein CARUB_v10008506mg [Caps... 56 5e-06 ref|XP_002265178.2| PREDICTED: nucleolar GTP-binding protein 1-l... 56 5e-06 ref|XP_002285463.1| PREDICTED: nucleolar GTP-binding protein 1-l... 56 5e-06 ref|XP_002513509.1| nucleolar GTP-binding protein, putative [Ric... 56 5e-06 emb|CAN65615.1| hypothetical protein VITISV_024726 [Vitis vinifera] 56 5e-06 ref|XP_006489815.1| PREDICTED: nucleolar GTP-binding protein 1-l... 56 6e-06 >ref|XP_006418099.1| hypothetical protein EUTSA_v10006811mg [Eutrema salsugineum] gi|557095870|gb|ESQ36452.1| hypothetical protein EUTSA_v10006811mg [Eutrema salsugineum] Length = 817 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 139 KMVQINFKKITVVPNGKDFVDIILSRTQRQ 228 KMVQ NFKKITVVPNGK+FVDIILSRTQRQ Sbjct: 146 KMVQYNFKKITVVPNGKEFVDIILSRTQRQ 175 >ref|XP_006367799.1| PREDICTED: nucleolar GTP-binding protein 1-like isoform X1 [Solanum tuberosum] gi|565404772|ref|XP_006367800.1| PREDICTED: nucleolar GTP-binding protein 1-like isoform X2 [Solanum tuberosum] Length = 680 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 142 MVQINFKKITVVPNGKDFVDIILSRTQRQ 228 MVQ NFKKITVVPNGKDFVDIILSRTQRQ Sbjct: 1 MVQYNFKKITVVPNGKDFVDIILSRTQRQ 29 >ref|XP_007132018.1| hypothetical protein PHAVU_011G059700g [Phaseolus vulgaris] gi|561005018|gb|ESW04012.1| hypothetical protein PHAVU_011G059700g [Phaseolus vulgaris] Length = 677 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 142 MVQINFKKITVVPNGKDFVDIILSRTQRQ 228 MVQ NFKKITVVPNGKDFVDIILSRTQRQ Sbjct: 1 MVQYNFKKITVVPNGKDFVDIILSRTQRQ 29 >ref|XP_002299913.2| nucleolar GTP-binding protein 1 [Populus trichocarpa] gi|550348244|gb|EEE84718.2| nucleolar GTP-binding protein 1 [Populus trichocarpa] Length = 676 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 142 MVQINFKKITVVPNGKDFVDIILSRTQRQ 228 MVQ NFKKITVVPNGKDFVDIILSRTQRQ Sbjct: 1 MVQYNFKKITVVPNGKDFVDIILSRTQRQ 29 >ref|XP_004489044.1| PREDICTED: nucleolar GTP-binding protein 1-like [Cicer arietinum] Length = 673 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 142 MVQINFKKITVVPNGKDFVDIILSRTQRQ 228 MVQ NFKKITVVPNGKDFVDIILSRTQRQ Sbjct: 1 MVQYNFKKITVVPNGKDFVDIILSRTQRQ 29 >ref|XP_004243372.1| PREDICTED: nucleolar GTP-binding protein 1-like [Solanum lycopersicum] Length = 680 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 142 MVQINFKKITVVPNGKDFVDIILSRTQRQ 228 MVQ NFKKITVVPNGKDFVDIILSRTQRQ Sbjct: 1 MVQYNFKKITVVPNGKDFVDIILSRTQRQ 29 >ref|XP_004229516.1| PREDICTED: nucleolar GTP-binding protein 1-like [Solanum lycopersicum] Length = 680 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 142 MVQINFKKITVVPNGKDFVDIILSRTQRQ 228 MVQ NFKKITVVPNGKDFVDIILSRTQRQ Sbjct: 1 MVQYNFKKITVVPNGKDFVDIILSRTQRQ 29 >ref|XP_003627147.1| hypothetical protein MTR_8g018150 [Medicago truncatula] gi|355521169|gb|AET01623.1| hypothetical protein MTR_8g018150 [Medicago truncatula] Length = 867 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 142 MVQINFKKITVVPNGKDFVDIILSRTQRQ 228 MVQ NFKKITVVPNGKDFVDIILSRTQRQ Sbjct: 1 MVQYNFKKITVVPNGKDFVDIILSRTQRQ 29 >gb|EXB93299.1| Nucleolar GTP-binding protein 1 [Morus notabilis] Length = 679 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 142 MVQINFKKITVVPNGKDFVDIILSRTQRQ 228 MVQ NFKKITVVPNGKDF+DIILSRTQRQ Sbjct: 1 MVQYNFKKITVVPNGKDFIDIILSRTQRQ 29 >ref|XP_007029236.1| Nucleolar GTP-binding protein [Theobroma cacao] gi|508717841|gb|EOY09738.1| Nucleolar GTP-binding protein [Theobroma cacao] Length = 674 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 142 MVQINFKKITVVPNGKDFVDIILSRTQRQ 228 MVQ NFKKITVVPNGKDF+DIILSRTQRQ Sbjct: 1 MVQYNFKKITVVPNGKDFIDIILSRTQRQ 29 >ref|XP_004142938.1| PREDICTED: nucleolar GTP-binding protein 1-like [Cucumis sativus] gi|449494450|ref|XP_004159549.1| PREDICTED: nucleolar GTP-binding protein 1-like [Cucumis sativus] Length = 675 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 142 MVQINFKKITVVPNGKDFVDIILSRTQRQ 228 MVQ NFKKITVVPNGKDF+DIILSRTQRQ Sbjct: 1 MVQYNFKKITVVPNGKDFIDIILSRTQRQ 29 >ref|XP_007210791.1| hypothetical protein PRUPE_ppa018546mg [Prunus persica] gi|462406526|gb|EMJ11990.1| hypothetical protein PRUPE_ppa018546mg [Prunus persica] Length = 504 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 142 MVQINFKKITVVPNGKDFVDIILSRTQRQ 228 MVQ NFKK+TVVPNGKDF+DIILSRTQRQ Sbjct: 1 MVQYNFKKMTVVPNGKDFIDIILSRTQRQ 29 >ref|XP_007210301.1| hypothetical protein PRUPE_ppa002488mg [Prunus persica] gi|462406036|gb|EMJ11500.1| hypothetical protein PRUPE_ppa002488mg [Prunus persica] Length = 668 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 142 MVQINFKKITVVPNGKDFVDIILSRTQRQ 228 MVQ NFKK+TVVPNGKDF+DIILSRTQRQ Sbjct: 1 MVQYNFKKMTVVPNGKDFIDIILSRTQRQ 29 >ref|XP_007206320.1| hypothetical protein PRUPE_ppa002518mg [Prunus persica] gi|462401962|gb|EMJ07519.1| hypothetical protein PRUPE_ppa002518mg [Prunus persica] Length = 663 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 142 MVQINFKKITVVPNGKDFVDIILSRTQRQ 228 MVQ NFKK+TVVPNGKDF+DIILSRTQRQ Sbjct: 1 MVQYNFKKMTVVPNGKDFIDIILSRTQRQ 29 >ref|XP_006306939.1| hypothetical protein CARUB_v10008506mg [Capsella rubella] gi|482575650|gb|EOA39837.1| hypothetical protein CARUB_v10008506mg [Capsella rubella] Length = 671 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 142 MVQINFKKITVVPNGKDFVDIILSRTQRQ 228 MVQ NFKKITVVPNGK+F+DIILSRTQRQ Sbjct: 1 MVQYNFKKITVVPNGKEFIDIILSRTQRQ 29 >ref|XP_002265178.2| PREDICTED: nucleolar GTP-binding protein 1-like [Vitis vinifera] Length = 676 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 142 MVQINFKKITVVPNGKDFVDIILSRTQRQ 228 MVQ NFKKITVVPNGK+F+DIILSRTQRQ Sbjct: 1 MVQYNFKKITVVPNGKEFIDIILSRTQRQ 29 >ref|XP_002285463.1| PREDICTED: nucleolar GTP-binding protein 1-like [Vitis vinifera] Length = 676 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 142 MVQINFKKITVVPNGKDFVDIILSRTQRQ 228 MVQ NFKKITVVPNGK+F+DIILSRTQRQ Sbjct: 1 MVQYNFKKITVVPNGKEFIDIILSRTQRQ 29 >ref|XP_002513509.1| nucleolar GTP-binding protein, putative [Ricinus communis] gi|223547417|gb|EEF48912.1| nucleolar GTP-binding protein, putative [Ricinus communis] Length = 678 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 142 MVQINFKKITVVPNGKDFVDIILSRTQRQ 228 MVQ NFKKITVVP+GKDFVDIILSRTQRQ Sbjct: 1 MVQYNFKKITVVPSGKDFVDIILSRTQRQ 29 >emb|CAN65615.1| hypothetical protein VITISV_024726 [Vitis vinifera] Length = 674 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 142 MVQINFKKITVVPNGKDFVDIILSRTQRQ 228 MVQ NFKKITVVPNGK+F+DIILSRTQRQ Sbjct: 1 MVQYNFKKITVVPNGKEFIDIILSRTQRQ 29 >ref|XP_006489815.1| PREDICTED: nucleolar GTP-binding protein 1-like [Citrus sinensis] Length = 676 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 142 MVQINFKKITVVPNGKDFVDIILSRTQRQ 228 MVQ NFKKITVVPNGKD VDIILSRTQRQ Sbjct: 1 MVQYNFKKITVVPNGKDIVDIILSRTQRQ 29