BLASTX nr result
ID: Paeonia24_contig00030242
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00030242 (779 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284146.1| PREDICTED: probable mitochondrial saccharopi... 56 6e-06 >ref|XP_002284146.1| PREDICTED: probable mitochondrial saccharopine dehydrogenase At5g39410-like [Vitis vinifera] Length = 451 Score = 56.2 bits (134), Expect(2) = 6e-06 Identities = 30/57 (52%), Positives = 35/57 (61%) Frame = +3 Query: 324 GCIIHRVCGEPKFFKRMEAVYSKKVLEKGSLVVLAWGLTPFWLEKLGLMFNLR*WTT 494 GC +CGEP+F +RME Y +K EKGSLVV A G E LGLMFN R W + Sbjct: 117 GCDYLDICGEPEFMERMEVAYHEKASEKGSLVVSACGFDSVPAE-LGLMFNSRQWVS 172 Score = 20.8 bits (42), Expect(2) = 6e-06 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = +1 Query: 280 KPAMSDFIKSSCDYLGV 330 +P ++ ++S CDYL + Sbjct: 107 EPVVAACVESGCDYLDI 123