BLASTX nr result
ID: Paeonia24_contig00030230
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00030230 (432 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74485.1| hypothetical protein M569_00274, partial [Genlise... 57 2e-06 >gb|EPS74485.1| hypothetical protein M569_00274, partial [Genlisea aurea] Length = 80 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 382 KEREGFKPSIVLCLELYQFSRPELSTARPSLQK 284 KEREGF+PSIVLC +LY+FSRPELST +PSL+K Sbjct: 3 KEREGFEPSIVLCSKLYRFSRPELSTPQPSLRK 35