BLASTX nr result
ID: Paeonia24_contig00028875
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00028875 (782 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002321154.1| photoregulatory zinc-finger protein COP1 [Po... 69 2e-09 ref|XP_002534127.1| ubiquitin ligase protein cop1, putative [Ric... 65 2e-08 gb|EYU43138.1| hypothetical protein MIMGU_mgv1a002549mg [Mimulus... 64 5e-08 emb|CAB89693.1| constitutively photomorphogenic 1 protein [Pisum... 63 1e-07 ref|XP_006410433.1| hypothetical protein EUTSA_v10016348mg [Eutr... 62 2e-07 ref|XP_006293448.1| hypothetical protein CARUB_v10022726mg [Caps... 62 2e-07 gb|AAA32772.1| regulatory protein [Arabidopsis thaliana] 62 2e-07 ref|NP_180854.1| E3 ubiquitin-protein ligase COP1 [Arabidopsis t... 62 2e-07 ref|XP_002879425.1| hypothetical protein ARALYDRAFT_902362 [Arab... 62 2e-07 dbj|BAE98955.1| photomorphogenesis repressor [Arabidopsis thaliana] 62 2e-07 ref|XP_002270330.2| PREDICTED: E3 ubiquitin-protein ligase COP1-... 62 2e-07 emb|CBI41056.3| unnamed protein product [Vitis vinifera] 62 2e-07 gb|ADL59932.1| constitutively photomorphogenic 1 [Brassica napus] 62 3e-07 gb|ADR72985.1| COP1 protein [Brassica rapa var. purpuraria] gi|3... 62 3e-07 gb|EXB72970.1| E3 ubiquitin-protein ligase COP1 [Morus notabilis] 61 4e-07 gb|AHL58685.1| E3 ubiquitin ligase [Carya cathayensis] 61 5e-07 ref|XP_004300230.1| PREDICTED: E3 ubiquitin-protein ligase COP1-... 61 5e-07 ref|XP_007210464.1| hypothetical protein PRUPE_ppa002554m1g, par... 61 5e-07 gb|AEE81754.1| constitutively photomorphogenic 1 [Brassica rapa ... 61 5e-07 gb|AAK81856.1|AF394913_1 photoregulatory zinc-finger protein COP... 61 5e-07 >ref|XP_002321154.1| photoregulatory zinc-finger protein COP1 [Populus trichocarpa] gi|222861927|gb|EEE99469.1| photoregulatory zinc-finger protein COP1 [Populus trichocarpa] Length = 672 Score = 68.6 bits (166), Expect = 2e-09 Identities = 34/60 (56%), Positives = 47/60 (78%), Gaps = 1/60 (1%) Frame = -3 Query: 201 FIKNLRQGCKVLVKDLDNTLPLLSENSKETYQE-AEMNMKILLDLLHYLRKQKL*ELNKV 25 F ++L+QGC+V +KDLD + LL+E ++ QE AE NM++LLD LHYLRKQK+ ELN+V Sbjct: 123 FRQSLQQGCEVSIKDLDTLMSLLAERKRKMEQEEAERNMQVLLDFLHYLRKQKVDELNEV 182 >ref|XP_002534127.1| ubiquitin ligase protein cop1, putative [Ricinus communis] gi|223525812|gb|EEF28255.1| ubiquitin ligase protein cop1, putative [Ricinus communis] Length = 677 Score = 65.5 bits (158), Expect = 2e-08 Identities = 32/56 (57%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = -3 Query: 189 LRQGCKVLVKDLDNTLPLLSENSKETYQE-AEMNMKILLDLLHYLRKQKL*ELNKV 25 L+QGC++ +K+LD + +LSE ++ QE AE NM+ILLD LHYLRKQK+ ELN+V Sbjct: 131 LQQGCEISIKELDTLMSMLSEKKRKMEQEEAERNMQILLDFLHYLRKQKVDELNEV 186 >gb|EYU43138.1| hypothetical protein MIMGU_mgv1a002549mg [Mimulus guttatus] Length = 660 Score = 64.3 bits (155), Expect = 5e-08 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 1/60 (1%) Frame = -3 Query: 201 FIKNLRQGCKVLVKDLDNTLPLLSENSKETYQE-AEMNMKILLDLLHYLRKQKL*ELNKV 25 F ++L QGC+V VK+LD+ L LL+E ++ QE AE NM+ILLD LH LRKQK ELN+V Sbjct: 109 FRQSLEQGCEVSVKELDSLLSLLAEKKRKLEQEEAERNMQILLDFLHCLRKQKANELNEV 168 >emb|CAB89693.1| constitutively photomorphogenic 1 protein [Pisum sativum] Length = 675 Score = 62.8 bits (151), Expect = 1e-07 Identities = 33/59 (55%), Positives = 44/59 (74%), Gaps = 1/59 (1%) Frame = -3 Query: 198 IKNLRQGCKVLVKDLDNTLPLLSENSKETYQE-AEMNMKILLDLLHYLRKQKL*ELNKV 25 ++ L+QGC+V +K+LD L LL+E ++ QE AE NM+ILLD LH LRKQK+ EL KV Sbjct: 125 VQKLKQGCEVTMKELDTLLLLLTEKKRKMEQEEAERNMQILLDFLHCLRKQKVDELKKV 183 >ref|XP_006410433.1| hypothetical protein EUTSA_v10016348mg [Eutrema salsugineum] gi|557111602|gb|ESQ51886.1| hypothetical protein EUTSA_v10016348mg [Eutrema salsugineum] Length = 678 Score = 62.4 bits (150), Expect = 2e-07 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 1/60 (1%) Frame = -3 Query: 201 FIKNLRQGCKVLVKDLDNTLPLLSENSKETYQE-AEMNMKILLDLLHYLRKQKL*ELNKV 25 F + L++GC V +K++DN L LL+E ++ QE AE NM+ILLD LH LRKQK+ ELN+V Sbjct: 129 FREALQRGCDVSIKEVDNLLSLLAERKRKMEQEEAERNMQILLDFLHCLRKQKVDELNEV 188 >ref|XP_006293448.1| hypothetical protein CARUB_v10022726mg [Capsella rubella] gi|482562156|gb|EOA26346.1| hypothetical protein CARUB_v10022726mg [Capsella rubella] Length = 723 Score = 62.4 bits (150), Expect = 2e-07 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 1/60 (1%) Frame = -3 Query: 201 FIKNLRQGCKVLVKDLDNTLPLLSENSKETYQE-AEMNMKILLDLLHYLRKQKL*ELNKV 25 F + L++GC V +K++DN L LL+E ++ QE AE NM+ILLD LH LRKQK+ ELN+V Sbjct: 174 FREALQRGCDVSIKEVDNLLSLLAERKRKIEQEEAERNMQILLDFLHCLRKQKVDELNEV 233 >gb|AAA32772.1| regulatory protein [Arabidopsis thaliana] Length = 675 Score = 62.4 bits (150), Expect = 2e-07 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 1/60 (1%) Frame = -3 Query: 201 FIKNLRQGCKVLVKDLDNTLPLLSENSKETYQE-AEMNMKILLDLLHYLRKQKL*ELNKV 25 F + L++GC V +K++DN L LL+E ++ QE AE NM+ILLD LH LRKQK+ ELN+V Sbjct: 126 FREALQRGCDVSIKEVDNLLTLLAERKRKMEQEEAERNMQILLDFLHCLRKQKVDELNEV 185 >ref|NP_180854.1| E3 ubiquitin-protein ligase COP1 [Arabidopsis thaliana] gi|20141387|sp|P43254.2|COP1_ARATH RecName: Full=E3 ubiquitin-protein ligase COP1; AltName: Full=Constitutive photomorphogenesis protein 1 gi|2702280|gb|AAB91983.1| COP1 regulatory protein [Arabidopsis thaliana] gi|95147316|gb|ABF57293.1| At2g32950 [Arabidopsis thaliana] gi|330253672|gb|AEC08766.1| E3 ubiquitin-protein ligase COP1 [Arabidopsis thaliana] Length = 675 Score = 62.4 bits (150), Expect = 2e-07 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 1/60 (1%) Frame = -3 Query: 201 FIKNLRQGCKVLVKDLDNTLPLLSENSKETYQE-AEMNMKILLDLLHYLRKQKL*ELNKV 25 F + L++GC V +K++DN L LL+E ++ QE AE NM+ILLD LH LRKQK+ ELN+V Sbjct: 126 FREALQRGCDVSIKEVDNLLTLLAERKRKMEQEEAERNMQILLDFLHCLRKQKVDELNEV 185 >ref|XP_002879425.1| hypothetical protein ARALYDRAFT_902362 [Arabidopsis lyrata subsp. lyrata] gi|297325264|gb|EFH55684.1| hypothetical protein ARALYDRAFT_902362 [Arabidopsis lyrata subsp. lyrata] Length = 675 Score = 62.4 bits (150), Expect = 2e-07 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 1/60 (1%) Frame = -3 Query: 201 FIKNLRQGCKVLVKDLDNTLPLLSENSKETYQE-AEMNMKILLDLLHYLRKQKL*ELNKV 25 F + L++GC V +K++DN L LL+E ++ QE AE NM+ILLD LH LRKQK+ ELN+V Sbjct: 126 FREALQRGCDVSIKEVDNLLSLLAERKRKMEQEEAERNMQILLDFLHCLRKQKVDELNEV 185 >dbj|BAE98955.1| photomorphogenesis repressor [Arabidopsis thaliana] Length = 391 Score = 62.4 bits (150), Expect = 2e-07 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 1/60 (1%) Frame = -3 Query: 201 FIKNLRQGCKVLVKDLDNTLPLLSENSKETYQE-AEMNMKILLDLLHYLRKQKL*ELNKV 25 F + L++GC V +K++DN L LL+E ++ QE AE NM+ILLD LH LRKQK+ ELN+V Sbjct: 126 FREALQRGCDVSIKEVDNLLTLLAERKRKMEQEEAERNMQILLDFLHCLRKQKVDELNEV 185 >ref|XP_002270330.2| PREDICTED: E3 ubiquitin-protein ligase COP1-like [Vitis vinifera] Length = 687 Score = 62.0 bits (149), Expect = 2e-07 Identities = 33/56 (58%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = -3 Query: 189 LRQGCKVLVKDLDNTLPLLSENSKETYQE-AEMNMKILLDLLHYLRKQKL*ELNKV 25 L+QGC+V VK+LD+ + LL E ++ QE AE NM+ILLD LH LRKQKL ELN++ Sbjct: 142 LQQGCEVSVKELDSLMSLLVEKRRKMEQEEAETNMQILLDFLHCLRKQKLEELNEI 197 >emb|CBI41056.3| unnamed protein product [Vitis vinifera] Length = 602 Score = 62.0 bits (149), Expect = 2e-07 Identities = 33/56 (58%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = -3 Query: 189 LRQGCKVLVKDLDNTLPLLSENSKETYQE-AEMNMKILLDLLHYLRKQKL*ELNKV 25 L+QGC+V VK+LD+ + LL E ++ QE AE NM+ILLD LH LRKQKL ELN++ Sbjct: 57 LQQGCEVSVKELDSLMSLLVEKRRKMEQEEAETNMQILLDFLHCLRKQKLEELNEI 112 >gb|ADL59932.1| constitutively photomorphogenic 1 [Brassica napus] Length = 677 Score = 61.6 bits (148), Expect = 3e-07 Identities = 32/56 (57%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = -3 Query: 189 LRQGCKVLVKDLDNTLPLLSENSKETYQE-AEMNMKILLDLLHYLRKQKL*ELNKV 25 L++GC V +K++DN L LL+E ++ QE AE NM+ILLD LH LRKQK+ ELN+V Sbjct: 131 LQRGCDVSIKEVDNLLTLLAEKKRKMEQEEAERNMQILLDFLHCLRKQKVDELNEV 186 >gb|ADR72985.1| COP1 protein [Brassica rapa var. purpuraria] gi|338224822|gb|AEI89703.1| COP1 protein [Brassica rapa subsp. chinensis] Length = 676 Score = 61.6 bits (148), Expect = 3e-07 Identities = 32/56 (57%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = -3 Query: 189 LRQGCKVLVKDLDNTLPLLSENSKETYQE-AEMNMKILLDLLHYLRKQKL*ELNKV 25 L++GC V +K++DN L LL+E ++ QE AE NM+ILLD LH LRKQK+ ELN+V Sbjct: 131 LQRGCDVSIKEVDNLLTLLAEKKRKMEQEEAERNMQILLDFLHCLRKQKVDELNEV 186 >gb|EXB72970.1| E3 ubiquitin-protein ligase COP1 [Morus notabilis] Length = 682 Score = 61.2 bits (147), Expect = 4e-07 Identities = 32/60 (53%), Positives = 45/60 (75%), Gaps = 1/60 (1%) Frame = -3 Query: 201 FIKNLRQGCKVLVKDLDNTLPLLSENSKETYQE-AEMNMKILLDLLHYLRKQKL*ELNKV 25 F + L+QGC+V +K++D L LL++ ++ QE AE NM+ILLD LH LRKQK+ ELN+V Sbjct: 131 FRQALQQGCEVSIKEVDTLLALLADKKRKMEQEEAERNMQILLDFLHCLRKQKVEELNEV 190 >gb|AHL58685.1| E3 ubiquitin ligase [Carya cathayensis] Length = 683 Score = 60.8 bits (146), Expect = 5e-07 Identities = 31/60 (51%), Positives = 46/60 (76%), Gaps = 1/60 (1%) Frame = -3 Query: 201 FIKNLRQGCKVLVKDLDNTLPLLSENSKETYQE-AEMNMKILLDLLHYLRKQKL*ELNKV 25 F + L+QGC+V +K+LD+ L LL++ ++ QE AE NM+ILL LH+LR+QK+ ELN+V Sbjct: 132 FRRALQQGCEVSIKELDSLLSLLADKKRKMEQEEAERNMQILLTFLHHLRRQKVDELNEV 191 >ref|XP_004300230.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like [Fragaria vesca subsp. vesca] Length = 662 Score = 60.8 bits (146), Expect = 5e-07 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 1/60 (1%) Frame = -3 Query: 201 FIKNLRQGCKVLVKDLDNTLPLLSENSKETYQE-AEMNMKILLDLLHYLRKQKL*ELNKV 25 F + L+QGC+V +K+LD L LL+E ++ QE AE NM+ILLD L+ LRKQK+ ELN+V Sbjct: 125 FRQALQQGCEVSIKELDTLLALLTEKKRKMEQEEAERNMQILLDFLNCLRKQKVQELNEV 184 >ref|XP_007210464.1| hypothetical protein PRUPE_ppa002554m1g, partial [Prunus persica] gi|462406199|gb|EMJ11663.1| hypothetical protein PRUPE_ppa002554m1g, partial [Prunus persica] Length = 386 Score = 60.8 bits (146), Expect = 5e-07 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 1/60 (1%) Frame = -3 Query: 201 FIKNLRQGCKVLVKDLDNTLPLLSENSKETYQE-AEMNMKILLDLLHYLRKQKL*ELNKV 25 F + L+QGC+V +K+LD L LL+E ++ QE AE NM+ILLD L+ LRKQK+ ELN+V Sbjct: 125 FRQALQQGCEVSIKELDTLLTLLAEKKRKMEQEEAERNMQILLDFLNCLRKQKVEELNEV 184 >gb|AEE81754.1| constitutively photomorphogenic 1 [Brassica rapa subsp. rapa] Length = 677 Score = 60.8 bits (146), Expect = 5e-07 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = -3 Query: 189 LRQGCKVLVKDLDNTLPLLSENSKETYQE-AEMNMKILLDLLHYLRKQKL*ELNKV 25 L++GC V +K++DN L LL+E ++ QE AE NM+ILLD LH LRKQK ELN+V Sbjct: 131 LQRGCDVSIKEVDNLLTLLAEKKRKMEQEEAERNMQILLDFLHCLRKQKADELNEV 186 >gb|AAK81856.1|AF394913_1 photoregulatory zinc-finger protein COP1 [Rosa hybrid cultivar] Length = 662 Score = 60.8 bits (146), Expect = 5e-07 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 1/60 (1%) Frame = -3 Query: 201 FIKNLRQGCKVLVKDLDNTLPLLSENSKETYQE-AEMNMKILLDLLHYLRKQKL*ELNKV 25 F + L+QGC+V +K+LD L LL+E ++ QE AE NM+ILLD L+ LRKQK+ ELN+V Sbjct: 125 FRQALQQGCEVSIKELDTLLALLAEKKRKMEQEEAERNMQILLDFLNCLRKQKVQELNEV 184