BLASTX nr result
ID: Paeonia24_contig00028780
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00028780 (275 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276025.1| PREDICTED: uncharacterized protein C18orf8 [... 64 3e-08 ref|XP_006492827.1| PREDICTED: uncharacterized protein C18orf8-l... 63 4e-08 ref|XP_007204279.1| hypothetical protein PRUPE_ppa001568mg [Prun... 62 6e-08 ref|XP_006429920.1| hypothetical protein CICLE_v10013737mg [Citr... 62 1e-07 ref|XP_006381918.1| hypothetical protein POPTR_0006s20960g [Popu... 62 1e-07 ref|XP_006381917.1| hypothetical protein POPTR_0006s20960g [Popu... 62 1e-07 ref|XP_006381915.1| hypothetical protein POPTR_0006s20960g [Popu... 62 1e-07 ref|XP_006381914.1| hypothetical protein POPTR_0006s20960g [Popu... 62 1e-07 ref|XP_002534438.1| conserved hypothetical protein [Ricinus comm... 62 1e-07 ref|XP_007029054.1| Cultured cell, putative isoform 1 [Theobroma... 60 2e-07 gb|EYU39966.1| hypothetical protein MIMGU_mgv1a001809mg [Mimulus... 60 3e-07 ref|XP_002323334.2| hypothetical protein POPTR_0016s06050g [Popu... 60 3e-07 ref|XP_004493623.1| PREDICTED: uncharacterized protein C18orf8-l... 60 4e-07 ref|XP_004493621.1| PREDICTED: uncharacterized protein C18orf8-l... 60 4e-07 ref|XP_004166295.1| PREDICTED: uncharacterized protein LOC101227... 60 4e-07 ref|XP_004136556.1| PREDICTED: uncharacterized protein LOC101218... 60 4e-07 ref|XP_003625309.1| hypothetical protein MTR_7g093740 [Medicago ... 60 4e-07 ref|XP_006576872.1| PREDICTED: uncharacterized protein C18orf8-l... 59 5e-07 ref|XP_006849570.1| hypothetical protein AMTR_s00024p00184500 [A... 59 5e-07 ref|XP_006407381.1| hypothetical protein EUTSA_v10020623mg [Eutr... 59 7e-07 >ref|XP_002276025.1| PREDICTED: uncharacterized protein C18orf8 [Vitis vinifera] gi|297739807|emb|CBI29989.3| unnamed protein product [Vitis vinifera] Length = 696 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +2 Query: 2 EDIHIVTIYCRIYWL*VDRVIILLHGYWFYHDVVVYRGSFPIYS 133 ED+HI+T+Y RIY L VDRV +LLH Y FY D VV +GS PIYS Sbjct: 224 EDVHIITVYGRIYCLQVDRVAMLLHSYRFYRDAVVQQGSLPIYS 267 >ref|XP_006492827.1| PREDICTED: uncharacterized protein C18orf8-like [Citrus sinensis] Length = 748 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = +2 Query: 2 EDIHIVTIYCRIYWL*VDRVIILLHGYWFYHDVVVYRGSFPIYSS 136 ED++IVT+Y RIY L VDRV +LLH Y FY D VV +GS PIYSS Sbjct: 225 EDVYIVTVYGRIYCLQVDRVAMLLHSYRFYRDAVVQQGSLPIYSS 269 >ref|XP_007204279.1| hypothetical protein PRUPE_ppa001568mg [Prunus persica] gi|462399810|gb|EMJ05478.1| hypothetical protein PRUPE_ppa001568mg [Prunus persica] Length = 801 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/45 (68%), Positives = 34/45 (75%) Frame = +2 Query: 2 EDIHIVTIYCRIYWL*VDRVIILLHGYWFYHDVVVYRGSFPIYSS 136 EDI I TIY RIY L VDR+ +LLH Y FY DVVV +GS PIYSS Sbjct: 269 EDIFIATIYGRIYCLQVDRIAMLLHSYRFYRDVVVQQGSLPIYSS 313 >ref|XP_006429920.1| hypothetical protein CICLE_v10013737mg [Citrus clementina] gi|557531977|gb|ESR43160.1| hypothetical protein CICLE_v10013737mg [Citrus clementina] Length = 799 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +2 Query: 2 EDIHIVTIYCRIYWL*VDRVIILLHGYWFYHDVVVYRGSFPIYS 133 ED++IVT+Y RIY L VDRV +LLH Y FY D VV +GS PIYS Sbjct: 269 EDVYIVTVYGRIYCLQVDRVAMLLHSYRFYRDAVVQQGSLPIYS 312 >ref|XP_006381918.1| hypothetical protein POPTR_0006s20960g [Populus trichocarpa] gi|550336763|gb|ERP59715.1| hypothetical protein POPTR_0006s20960g [Populus trichocarpa] Length = 403 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = +2 Query: 2 EDIHIVTIYCRIYWL*VDRVIILLHGYWFYHDVVVYRGSFPIYSS 136 ED++I TIY RIY L +DRV +LLH Y FY D VV +GS PIYSS Sbjct: 224 EDVYIATIYGRIYCLQIDRVAMLLHSYRFYQDAVVQQGSLPIYSS 268 >ref|XP_006381917.1| hypothetical protein POPTR_0006s20960g [Populus trichocarpa] gi|550336762|gb|ERP59714.1| hypothetical protein POPTR_0006s20960g [Populus trichocarpa] Length = 544 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = +2 Query: 2 EDIHIVTIYCRIYWL*VDRVIILLHGYWFYHDVVVYRGSFPIYSS 136 ED++I TIY RIY L +DRV +LLH Y FY D VV +GS PIYSS Sbjct: 224 EDVYIATIYGRIYCLQIDRVAMLLHSYRFYQDAVVQQGSLPIYSS 268 >ref|XP_006381915.1| hypothetical protein POPTR_0006s20960g [Populus trichocarpa] gi|566177350|ref|XP_006381916.1| hypothetical protein POPTR_0006s20960g [Populus trichocarpa] gi|550336760|gb|ERP59712.1| hypothetical protein POPTR_0006s20960g [Populus trichocarpa] gi|550336761|gb|ERP59713.1| hypothetical protein POPTR_0006s20960g [Populus trichocarpa] Length = 698 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = +2 Query: 2 EDIHIVTIYCRIYWL*VDRVIILLHGYWFYHDVVVYRGSFPIYSS 136 ED++I TIY RIY L +DRV +LLH Y FY D VV +GS PIYSS Sbjct: 224 EDVYIATIYGRIYCLQIDRVAMLLHSYRFYQDAVVQQGSLPIYSS 268 >ref|XP_006381914.1| hypothetical protein POPTR_0006s20960g [Populus trichocarpa] gi|550336759|gb|ERP59711.1| hypothetical protein POPTR_0006s20960g [Populus trichocarpa] Length = 514 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = +2 Query: 2 EDIHIVTIYCRIYWL*VDRVIILLHGYWFYHDVVVYRGSFPIYSS 136 ED++I TIY RIY L +DRV +LLH Y FY D VV +GS PIYSS Sbjct: 40 EDVYIATIYGRIYCLQIDRVAMLLHSYRFYQDAVVQQGSLPIYSS 84 >ref|XP_002534438.1| conserved hypothetical protein [Ricinus communis] gi|223525295|gb|EEF27945.1| conserved hypothetical protein [Ricinus communis] Length = 692 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = +2 Query: 2 EDIHIVTIYCRIYWL*VDRVIILLHGYWFYHDVVVYRGSFPIYSS 136 EDI+I T+Y RIY L +DRV +LLH Y FY D VV +GS PIYSS Sbjct: 224 EDIYIATVYGRIYCLQIDRVAMLLHSYRFYRDAVVQQGSLPIYSS 268 >ref|XP_007029054.1| Cultured cell, putative isoform 1 [Theobroma cacao] gi|590637214|ref|XP_007029055.1| Cultured cell, putative isoform 1 [Theobroma cacao] gi|590637218|ref|XP_007029056.1| Cultured cell, putative isoform 1 [Theobroma cacao] gi|508717659|gb|EOY09556.1| Cultured cell, putative isoform 1 [Theobroma cacao] gi|508717660|gb|EOY09557.1| Cultured cell, putative isoform 1 [Theobroma cacao] gi|508717661|gb|EOY09558.1| Cultured cell, putative isoform 1 [Theobroma cacao] Length = 754 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = +2 Query: 2 EDIHIVTIYCRIYWL*VDRVIILLHGYWFYHDVVVYRGSFPIYSS 136 ED++IVT+Y RIY L VDRV ++LH Y FY D VV +GS PIYSS Sbjct: 224 EDVYIVTVYGRIYCLQVDRVAMVLHLYRFYRDAVVQQGSLPIYSS 268 >gb|EYU39966.1| hypothetical protein MIMGU_mgv1a001809mg [Mimulus guttatus] Length = 757 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +2 Query: 2 EDIHIVTIYCRIYWL*VDRVIILLHGYWFYHDVVVYRGSFPIYSS 136 ED+HI+T+Y RIY L DR+ +LLH Y FY D VV +GS P+YS+ Sbjct: 297 EDVHIITVYGRIYCLQFDRIGMLLHSYRFYRDAVVQQGSLPVYSN 341 >ref|XP_002323334.2| hypothetical protein POPTR_0016s06050g [Populus trichocarpa] gi|550320945|gb|EEF05095.2| hypothetical protein POPTR_0016s06050g [Populus trichocarpa] Length = 782 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = +2 Query: 2 EDIHIVTIYCRIYWL*VDRVIILLHGYWFYHDVVVYRGSFPIYSS 136 ED++I TIY RIY L +DR+ +LLH Y FY D VV +GS PIYS+ Sbjct: 296 EDVYIATIYGRIYCLQIDRIAMLLHSYRFYRDAVVQQGSLPIYSN 340 >ref|XP_004493623.1| PREDICTED: uncharacterized protein C18orf8-like isoform X3 [Cicer arietinum] Length = 688 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = +2 Query: 2 EDIHIVTIYCRIYWL*VDRVIILLHGYWFYHDVVVYRGSFPIYSS 136 EDI IVT+Y RIY L VDRV +LLH Y Y D V+ +GS PIYSS Sbjct: 224 EDIFIVTVYGRIYCLQVDRVAMLLHSYRLYRDAVIQQGSLPIYSS 268 >ref|XP_004493621.1| PREDICTED: uncharacterized protein C18orf8-like isoform X1 [Cicer arietinum] gi|502109340|ref|XP_004493622.1| PREDICTED: uncharacterized protein C18orf8-like isoform X2 [Cicer arietinum] Length = 739 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = +2 Query: 2 EDIHIVTIYCRIYWL*VDRVIILLHGYWFYHDVVVYRGSFPIYSS 136 EDI IVT+Y RIY L VDRV +LLH Y Y D V+ +GS PIYSS Sbjct: 224 EDIFIVTVYGRIYCLQVDRVAMLLHSYRLYRDAVIQQGSLPIYSS 268 >ref|XP_004166295.1| PREDICTED: uncharacterized protein LOC101227142 [Cucumis sativus] Length = 730 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = +2 Query: 2 EDIHIVTIYCRIYWL*VDRVIILLHGYWFYHDVVVYRGSFPIYSS 136 ED+ I+T+Y RIY L VDR+ +LLH Y FY D VV +GS PIYSS Sbjct: 224 EDVFIITVYGRIYCLQVDRLAMLLHTYRFYRDAVVQQGSLPIYSS 268 >ref|XP_004136556.1| PREDICTED: uncharacterized protein LOC101218836 [Cucumis sativus] Length = 730 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = +2 Query: 2 EDIHIVTIYCRIYWL*VDRVIILLHGYWFYHDVVVYRGSFPIYSS 136 ED+ I+T+Y RIY L VDR+ +LLH Y FY D VV +GS PIYSS Sbjct: 224 EDVFIITVYGRIYCLQVDRLAMLLHTYRFYRDAVVQQGSLPIYSS 268 >ref|XP_003625309.1| hypothetical protein MTR_7g093740 [Medicago truncatula] gi|355500324|gb|AES81527.1| hypothetical protein MTR_7g093740 [Medicago truncatula] Length = 730 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = +2 Query: 2 EDIHIVTIYCRIYWL*VDRVIILLHGYWFYHDVVVYRGSFPIYSS 136 EDI IVT+Y RIY L VDRV +LLH Y Y D V+ +GS PIYSS Sbjct: 224 EDIFIVTVYGRIYCLQVDRVAMLLHSYRLYRDAVIQQGSLPIYSS 268 >ref|XP_006576872.1| PREDICTED: uncharacterized protein C18orf8-like isoform X1 [Glycine max] gi|571445678|ref|XP_006576873.1| PREDICTED: uncharacterized protein C18orf8-like isoform X2 [Glycine max] gi|571445680|ref|XP_006576874.1| PREDICTED: uncharacterized protein C18orf8-like isoform X3 [Glycine max] gi|571445682|ref|XP_006576875.1| PREDICTED: uncharacterized protein C18orf8-like isoform X4 [Glycine max] gi|571445684|ref|XP_006576876.1| PREDICTED: uncharacterized protein C18orf8-like isoform X5 [Glycine max] gi|571445686|ref|XP_006576877.1| PREDICTED: uncharacterized protein C18orf8-like isoform X6 [Glycine max] gi|571445688|ref|XP_006576878.1| PREDICTED: uncharacterized protein C18orf8-like isoform X7 [Glycine max] gi|571445690|ref|XP_006576879.1| PREDICTED: uncharacterized protein C18orf8-like isoform X8 [Glycine max] Length = 739 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = +2 Query: 2 EDIHIVTIYCRIYWL*VDRVIILLHGYWFYHDVVVYRGSFPIYSS 136 ED+ IVT+Y RIY L VDRV +LLH Y Y D V+ +GS PIYSS Sbjct: 224 EDVFIVTVYGRIYCLQVDRVAMLLHSYRLYRDAVIQQGSLPIYSS 268 >ref|XP_006849570.1| hypothetical protein AMTR_s00024p00184500 [Amborella trichopoda] gi|548853145|gb|ERN11151.1| hypothetical protein AMTR_s00024p00184500 [Amborella trichopoda] Length = 817 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +2 Query: 2 EDIHIVTIYCRIYWL*VDRVIILLHGYWFYHDVVVYRGSFPIYS 133 ED+HI TIY RIY + VD+V +LLH Y FY D VV++GS PIYS Sbjct: 262 EDVHIATIYGRIYCIQVDQVGMLLHFYRFYRDAVVHQGSLPIYS 305 >ref|XP_006407381.1| hypothetical protein EUTSA_v10020623mg [Eutrema salsugineum] gi|557108527|gb|ESQ48834.1| hypothetical protein EUTSA_v10020623mg [Eutrema salsugineum] Length = 481 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = +2 Query: 5 DIHIVTIYCRIYWL*VDRVIILLHGYWFYHDVVVYRGSFPIYSS 136 D+H++T+Y RIY L VDR +LLH Y FY D VV +GS PIYS+ Sbjct: 18 DVHLITVYGRIYCLQVDREAMLLHSYRFYRDAVVQQGSLPIYST 61