BLASTX nr result
ID: Paeonia24_contig00028595
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00028595 (571 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535423.1| pentatricopeptide repeat-containing protein,... 41 5e-06 >ref|XP_002535423.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223523164|gb|EEF26960.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 563 Score = 40.8 bits (94), Expect(2) = 5e-06 Identities = 18/30 (60%), Positives = 22/30 (73%) Frame = +1 Query: 481 GVGLDLYIENVLVDLYARFNYFLKAHHMFE 570 G G DLYI N LVD+YARF +KA ++FE Sbjct: 63 GFGFDLYIGNALVDMYARFGDLVKARNVFE 92 Score = 35.4 bits (80), Expect(2) = 5e-06 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 6/47 (12%) Frame = +2 Query: 368 NMYFK--PFN----SYLSPTVINVYPGLLDFEVGKIIYGYVLEVVLG 490 ++YFK FN +Y P+VIN L DFE+G ++ +VLE+ G Sbjct: 19 DLYFKMKDFNVKPDTYTFPSVINACAALGDFEIGNVVQNHVLEIGFG 65