BLASTX nr result
ID: Paeonia24_contig00028485
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00028485 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006830002.1| hypothetical protein AMTR_s00251p00013890 [A... 68 2e-09 >ref|XP_006830002.1| hypothetical protein AMTR_s00251p00013890 [Amborella trichopoda] gi|548835726|gb|ERM97418.1| hypothetical protein AMTR_s00251p00013890 [Amborella trichopoda] Length = 111 Score = 67.8 bits (164), Expect = 2e-09 Identities = 37/57 (64%), Positives = 44/57 (77%), Gaps = 1/57 (1%) Frame = -2 Query: 318 GIDHYSKYSKAENCCSLERRSAED-DLSEVRV*N*AFRMIKTKNC*VSLEKPTQISY 151 GIDHYS++SKAENCCSLER S E +EVRV + AF+MIKT+ VSL +P QISY Sbjct: 55 GIDHYSQFSKAENCCSLERLSVEGIPTTEVRVWDWAFQMIKTQKFFVSLIEPMQISY 111