BLASTX nr result
ID: Paeonia24_contig00028373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00028373 (334 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACM48123.1| calcium antiporter 1 [Malus domestica] gi|2235879... 59 9e-07 ref|XP_003615635.1| Vacuolar cation/proton exchanger [Medicago t... 56 5e-06 ref|XP_002876107.1| hypothetical protein ARALYDRAFT_485541 [Arab... 56 6e-06 >gb|ACM48123.1| calcium antiporter 1 [Malus domestica] gi|223587975|gb|ACM48122.1| calcium antiporter 1 [Malus domestica] Length = 450 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/47 (65%), Positives = 39/47 (82%), Gaps = 3/47 (6%) Frame = +3 Query: 3 SHYIKGLVLLLCYIVISACFFVLKTP--QSNGLE-GLRSSYGEVVHA 134 SHY+KGLVLLLCYI+I+ACFFV+K+P QSN L GL++S G V+ A Sbjct: 404 SHYLKGLVLLLCYIIIAACFFVIKSPLHQSNILHPGLQTSTGAVLGA 450 >ref|XP_003615635.1| Vacuolar cation/proton exchanger [Medicago truncatula] gi|355516970|gb|AES98593.1| Vacuolar cation/proton exchanger [Medicago truncatula] Length = 435 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +3 Query: 3 SHYIKGLVLLLCYIVISACFFVLKTPQSN 89 SHY+KG++L LCYIVISACFFVLKTPQ N Sbjct: 400 SHYLKGVILTLCYIVISACFFVLKTPQIN 428 >ref|XP_002876107.1| hypothetical protein ARALYDRAFT_485541 [Arabidopsis lyrata subsp. lyrata] gi|297321945|gb|EFH52366.1| hypothetical protein ARALYDRAFT_485541 [Arabidopsis lyrata subsp. lyrata] Length = 458 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/47 (59%), Positives = 38/47 (80%), Gaps = 3/47 (6%) Frame = +3 Query: 3 SHYIKGLVLLLCYIVISACFFVLKTPQSNGLE-GLR--SSYGEVVHA 134 SHY+KGLVLLLCY++I+ACFFV + PQ NG++ GL+ ++ GEV A Sbjct: 412 SHYMKGLVLLLCYVIIAACFFVDQIPQPNGIDVGLQPMNNLGEVYPA 458