BLASTX nr result
ID: Paeonia24_contig00028250
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00028250 (247 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004162513.1| PREDICTED: uncharacterized mitochondrial pro... 55 8e-06 >ref|XP_004162513.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like [Cucumis sativus] Length = 209 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/56 (48%), Positives = 38/56 (67%) Frame = +2 Query: 59 DTGMLGCRPTSSPIDHISLVGNKEEPFTRSISLSVPVYQCLIGHLIYLSNTRPNIS 226 +TGMLGCRPT +PI+ +GN ++ + + YQ L+G LIYLS+TRP+IS Sbjct: 42 ETGMLGCRPTDTPIEFNCKLGNSDD----QVPVDKEQYQRLVGKLIYLSHTRPDIS 93