BLASTX nr result
ID: Paeonia24_contig00028042
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00028042 (224 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004490010.1| PREDICTED: single-stranded DNA-binding prote... 56 6e-06 ref|XP_004490009.1| PREDICTED: single-stranded DNA-binding prote... 56 6e-06 ref|XP_004490008.1| PREDICTED: single-stranded DNA-binding prote... 56 6e-06 >ref|XP_004490010.1| PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic-like isoform X3 [Cicer arietinum] Length = 242 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/53 (54%), Positives = 37/53 (69%) Frame = -2 Query: 223 GASKIS*EGCVLLQFTPAVDVQ*HEWSRKYVF*LSVSKAESPIILETKGRCEM 65 G+ KIS EGC+LLQF PAV V ++W+RK VF LSV++ S I L K CE+ Sbjct: 93 GSFKISREGCMLLQFAPAVGVHQYDWNRKQVFSLSVNEMGSLISLGAKDSCEI 145 >ref|XP_004490009.1| PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic-like isoform X2 [Cicer arietinum] Length = 261 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/53 (54%), Positives = 37/53 (69%) Frame = -2 Query: 223 GASKIS*EGCVLLQFTPAVDVQ*HEWSRKYVF*LSVSKAESPIILETKGRCEM 65 G+ KIS EGC+LLQF PAV V ++W+RK VF LSV++ S I L K CE+ Sbjct: 112 GSFKISREGCMLLQFAPAVGVHQYDWNRKQVFSLSVNEMGSLISLGAKDSCEI 164 >ref|XP_004490008.1| PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic-like isoform X1 [Cicer arietinum] Length = 255 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/53 (54%), Positives = 37/53 (69%) Frame = -2 Query: 223 GASKIS*EGCVLLQFTPAVDVQ*HEWSRKYVF*LSVSKAESPIILETKGRCEM 65 G+ KIS EGC+LLQF PAV V ++W+RK VF LSV++ S I L K CE+ Sbjct: 106 GSFKISREGCMLLQFAPAVGVHQYDWNRKQVFSLSVNEMGSLISLGAKDSCEI 158