BLASTX nr result
ID: Paeonia24_contig00028040
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00028040 (272 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007042494.1| Granulin repeat cysteine protease family pro... 67 3e-09 ref|XP_006346518.1| PREDICTED: cysteine proteinase RD21a-like [S... 65 8e-09 ref|XP_004230752.1| PREDICTED: cysteine proteinase RD21a-like [S... 65 8e-09 dbj|BAM66994.1| germination-specific cysteine protease 1, partia... 65 8e-09 ref|XP_002518705.1| cysteine protease, putative [Ricinus communi... 65 8e-09 gb|AEZ65082.1| cysteine protease [Carica papaya] 65 1e-08 ref|XP_006487026.1| PREDICTED: cysteine proteinase RD21a-like [C... 64 2e-08 ref|XP_006422960.1| hypothetical protein CICLE_v10028338mg [Citr... 64 2e-08 ref|XP_006283942.1| hypothetical protein CARUB_v10005061mg [Caps... 64 2e-08 ref|XP_004304028.1| PREDICTED: cysteine proteinase RD21a-like [F... 64 2e-08 ref|NP_195406.2| cysteine proteinase1 [Arabidopsis thaliana] gi|... 64 2e-08 dbj|BAE80740.1| cysteine proteinase [Platycodon grandiflorus] 64 2e-08 sp|Q94B08.2|GCP1_ARATH RecName: Full=Germination-specific cystei... 64 2e-08 dbj|BAF00916.1| cysteine proteinase [Arabidopsis thaliana] 64 2e-08 sp|P25251.1|CYSP4_BRANA RecName: Full=Cysteine proteinase COT44;... 64 3e-08 ref|XP_002313136.2| hypothetical protein POPTR_0009s10090g [Popu... 64 3e-08 gb|AAB23155.1| COT44=cysteine proteinase homolog [Brassica napus... 64 3e-08 gb|ABQ10202.1| cysteine protease Cp4 [Actinidia deliciosa] 64 3e-08 gb|EYU36326.1| hypothetical protein MIMGU_mgv1a005614mg [Mimulus... 63 5e-08 ref|XP_002310708.2| hypothetical protein POPTR_0007s10650g [Popu... 63 5e-08 >ref|XP_007042494.1| Granulin repeat cysteine protease family protein [Theobroma cacao] gi|508706429|gb|EOX98325.1| Granulin repeat cysteine protease family protein [Theobroma cacao] Length = 579 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +3 Query: 6 VERINQIVAGELITLSEQELVDCDKIYNQGCNRGLMNN 119 VE INQIV G+LI+LSEQELVDCD++YNQGCN GLM+N Sbjct: 284 VEGINQIVTGDLISLSEQELVDCDRLYNQGCNGGLMDN 321 >ref|XP_006346518.1| PREDICTED: cysteine proteinase RD21a-like [Solanum tuberosum] Length = 470 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +3 Query: 6 VERINQIVAGELITLSEQELVDCDKIYNQGCNRGLMN 116 VE INQIV GELI+LSEQELVDCDK YNQGCN GLM+ Sbjct: 171 VEGINQIVTGELISLSEQELVDCDKSYNQGCNGGLMD 207 >ref|XP_004230752.1| PREDICTED: cysteine proteinase RD21a-like [Solanum lycopersicum] Length = 470 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +3 Query: 6 VERINQIVAGELITLSEQELVDCDKIYNQGCNRGLMN 116 VE INQIV GELI+LSEQELVDCDK YNQGCN GLM+ Sbjct: 171 VEGINQIVTGELISLSEQELVDCDKSYNQGCNGGLMD 207 >dbj|BAM66994.1| germination-specific cysteine protease 1, partial [Raphanus sativus] Length = 235 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +3 Query: 3 VVERINQIVAGELITLSEQELVDCDKIYNQGCNRGLMN 116 VVE IN+IV GELI+LSEQELVDCDK YNQGCN GLM+ Sbjct: 36 VVEGINKIVTGELISLSEQELVDCDKSYNQGCNGGLMD 73 >ref|XP_002518705.1| cysteine protease, putative [Ricinus communis] gi|223542086|gb|EEF43630.1| cysteine protease, putative [Ricinus communis] Length = 471 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +3 Query: 6 VERINQIVAGELITLSEQELVDCDKIYNQGCNRGLMN 116 VE INQIV GELI+LSEQELVDCDK YNQGCN GLM+ Sbjct: 171 VEGINQIVTGELISLSEQELVDCDKSYNQGCNGGLMD 207 >gb|AEZ65082.1| cysteine protease [Carica papaya] Length = 471 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +3 Query: 6 VERINQIVAGELITLSEQELVDCDKIYNQGCNRGLMN 116 VE INQIV G+LI+LSEQELVDCDK YNQGCN GLM+ Sbjct: 175 VEGINQIVTGDLISLSEQELVDCDKAYNQGCNGGLMD 211 >ref|XP_006487026.1| PREDICTED: cysteine proteinase RD21a-like [Citrus sinensis] Length = 472 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +3 Query: 6 VERINQIVAGELITLSEQELVDCDKIYNQGCNRGLMN 116 VE INQIV G+LI+LSEQELVDCDK YNQGCN GLM+ Sbjct: 171 VEGINQIVTGDLISLSEQELVDCDKQYNQGCNGGLMD 207 >ref|XP_006422960.1| hypothetical protein CICLE_v10028338mg [Citrus clementina] gi|557524894|gb|ESR36200.1| hypothetical protein CICLE_v10028338mg [Citrus clementina] Length = 479 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +3 Query: 6 VERINQIVAGELITLSEQELVDCDKIYNQGCNRGLMN 116 VE INQIV G+LI+LSEQELVDCDK YNQGCN GLM+ Sbjct: 178 VEGINQIVTGDLISLSEQELVDCDKQYNQGCNGGLMD 214 >ref|XP_006283942.1| hypothetical protein CARUB_v10005061mg [Capsella rubella] gi|482552647|gb|EOA16840.1| hypothetical protein CARUB_v10005061mg [Capsella rubella] Length = 376 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +3 Query: 6 VERINQIVAGELITLSEQELVDCDKIYNQGCNRGLMN 116 VE IN+IV GEL++LSEQELVDCDK YNQGCN GLM+ Sbjct: 178 VEGINKIVTGELVSLSEQELVDCDKAYNQGCNGGLMD 214 >ref|XP_004304028.1| PREDICTED: cysteine proteinase RD21a-like [Fragaria vesca subsp. vesca] Length = 476 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +3 Query: 6 VERINQIVAGELITLSEQELVDCDKIYNQGCNRGLMN 116 VE IN+IV GELI+LSEQELVDCDK YNQGCN GLM+ Sbjct: 179 VEGINKIVTGELISLSEQELVDCDKSYNQGCNGGLMD 215 >ref|NP_195406.2| cysteine proteinase1 [Arabidopsis thaliana] gi|15290508|gb|AAK92229.1| cysteine proteinase [Arabidopsis thaliana] gi|332661313|gb|AEE86713.1| cysteine proteinase1 [Arabidopsis thaliana] Length = 376 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +3 Query: 6 VERINQIVAGELITLSEQELVDCDKIYNQGCNRGLMN 116 VE IN+IV GELI+LSEQELVDCDK YNQGCN GLM+ Sbjct: 178 VEGINKIVTGELISLSEQELVDCDKSYNQGCNGGLMD 214 >dbj|BAE80740.1| cysteine proteinase [Platycodon grandiflorus] Length = 462 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +3 Query: 6 VERINQIVAGELITLSEQELVDCDKIYNQGCNRGLMN 116 VE INQIV GELITLSEQELVDCDK YN+GC+ GLM+ Sbjct: 169 VEGINQIVTGELITLSEQELVDCDKSYNEGCDGGLMD 205 >sp|Q94B08.2|GCP1_ARATH RecName: Full=Germination-specific cysteine protease 1; Flags: Precursor gi|4006883|emb|CAB16767.1| cysteine proteinase [Arabidopsis thaliana] gi|7270637|emb|CAB80354.1| cysteine proteinase [Arabidopsis thaliana] Length = 376 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +3 Query: 6 VERINQIVAGELITLSEQELVDCDKIYNQGCNRGLMN 116 VE IN+IV GELI+LSEQELVDCDK YNQGCN GLM+ Sbjct: 178 VEGINKIVTGELISLSEQELVDCDKSYNQGCNGGLMD 214 >dbj|BAF00916.1| cysteine proteinase [Arabidopsis thaliana] Length = 376 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +3 Query: 6 VERINQIVAGELITLSEQELVDCDKIYNQGCNRGLMN 116 VE IN+IV GELI+LSEQELVDCDK YNQGCN GLM+ Sbjct: 178 VEGINKIVTGELISLSEQELVDCDKSYNQGCNGGLMD 214 >sp|P25251.1|CYSP4_BRANA RecName: Full=Cysteine proteinase COT44; Flags: Precursor Length = 328 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +3 Query: 6 VERINQIVAGELITLSEQELVDCDKIYNQGCNRGLMN 116 VE IN+IV GEL++LSEQELVDCDK YNQGCN GLM+ Sbjct: 133 VEGINKIVTGELVSLSEQELVDCDKSYNQGCNGGLMD 169 >ref|XP_002313136.2| hypothetical protein POPTR_0009s10090g [Populus trichocarpa] gi|550331427|gb|EEE87091.2| hypothetical protein POPTR_0009s10090g [Populus trichocarpa] Length = 477 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +3 Query: 6 VERINQIVAGELITLSEQELVDCDKIYNQGCNRGLMN 116 VE INQIV G L +LSEQELVDCDK+YNQGCN GLM+ Sbjct: 171 VEGINQIVTGNLTSLSEQELVDCDKVYNQGCNGGLMD 207 >gb|AAB23155.1| COT44=cysteine proteinase homolog [Brassica napus, seedling, rapid cycling base population CrGC5, Peptide, 328 aa] Length = 328 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +3 Query: 6 VERINQIVAGELITLSEQELVDCDKIYNQGCNRGLMN 116 VE IN+IV GEL++LSEQELVDCDK YNQGCN GLM+ Sbjct: 133 VEGINKIVTGELVSLSEQELVDCDKSYNQGCNGGLMD 169 >gb|ABQ10202.1| cysteine protease Cp4 [Actinidia deliciosa] Length = 463 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +3 Query: 6 VERINQIVAGELITLSEQELVDCDKIYNQGCNRGLMN 116 VE INQIV GELI+LSEQELVDCDK YN GCN GLM+ Sbjct: 167 VEGINQIVTGELISLSEQELVDCDKSYNMGCNGGLMD 203 >gb|EYU36326.1| hypothetical protein MIMGU_mgv1a005614mg [Mimulus guttatus] Length = 477 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +3 Query: 6 VERINQIVAGELITLSEQELVDCDKIYNQGCNRGLMN 116 VE INQI GELI+LSEQELVDCD+ YNQGCN GLM+ Sbjct: 181 VEGINQIATGELISLSEQELVDCDRSYNQGCNGGLMD 217 >ref|XP_002310708.2| hypothetical protein POPTR_0007s10650g [Populus trichocarpa] gi|550334591|gb|EEE91158.2| hypothetical protein POPTR_0007s10650g [Populus trichocarpa] Length = 376 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +3 Query: 6 VERINQIVAGELITLSEQELVDCDKIYNQGCNRGLMN 116 VE INQIV GELI+LSEQELVDCD+ YN GCN GLM+ Sbjct: 170 VEGINQIVTGELISLSEQELVDCDRFYNAGCNGGLMD 206