BLASTX nr result
ID: Paeonia24_contig00028027
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00028027 (316 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007199384.1| hypothetical protein PRUPE_ppa025810mg, part... 60 3e-07 ref|XP_007160454.1| hypothetical protein PHAVU_002G323600g [Phas... 57 2e-06 ref|XP_004308438.1| PREDICTED: uncharacterized protein LOC101291... 57 2e-06 ref|XP_007226893.1| hypothetical protein PRUPE_ppa016494mg, part... 57 3e-06 ref|XP_007206852.1| hypothetical protein PRUPE_ppa027128mg [Prun... 57 3e-06 gb|AFP55537.1| retrotransposon polyprotein [Rosa rugosa] 56 4e-06 ref|XP_007150263.1| hypothetical protein PHAVU_005G139500g [Phas... 56 6e-06 ref|XP_007203799.1| hypothetical protein PRUPE_ppb021461mg [Prun... 56 6e-06 >ref|XP_007199384.1| hypothetical protein PRUPE_ppa025810mg, partial [Prunus persica] gi|462394784|gb|EMJ00583.1| hypothetical protein PRUPE_ppa025810mg, partial [Prunus persica] Length = 283 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/49 (53%), Positives = 36/49 (73%) Frame = -1 Query: 154 ITEKLGRSNYVLWLAQILPWLRGRNLMGFVNGQKPCPSEFILDEEVKPT 8 I KL +NY LWLAQ++ L+GRN MG+V+G KPCP+ F+ D++ K T Sbjct: 20 IAIKLDGTNYPLWLAQVVRHLKGRNFMGYVDGTKPCPAYFLTDDQGKST 68 >ref|XP_007160454.1| hypothetical protein PHAVU_002G323600g [Phaseolus vulgaris] gi|561033869|gb|ESW32448.1| hypothetical protein PHAVU_002G323600g [Phaseolus vulgaris] Length = 283 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/52 (51%), Positives = 36/52 (69%) Frame = -1 Query: 172 PSFSGVITEKLGRSNYVLWLAQILPWLRGRNLMGFVNGQKPCPSEFILDEEV 17 PS S VI KL + NY+LW AQILP+LR + L+GFV+G P P++ I E + Sbjct: 13 PSISQVINVKLTQENYLLWSAQILPYLRSQGLVGFVDGSMPPPNQTITVESI 64 >ref|XP_004308438.1| PREDICTED: uncharacterized protein LOC101291974 [Fragaria vesca subsp. vesca] Length = 241 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/55 (52%), Positives = 36/55 (65%) Frame = -1 Query: 172 PSFSGVITEKLGRSNYVLWLAQILPWLRGRNLMGFVNGQKPCPSEFILDEEVKPT 8 P+ S ++ KL R+NY LWLAQI P L+ RNLMG+V+G CP F D E K T Sbjct: 42 PTVSNFLSIKLDRTNYPLWLAQIQPLLKSRNLMGYVDGTIGCPPCFQTDAEGKLT 96 >ref|XP_007226893.1| hypothetical protein PRUPE_ppa016494mg, partial [Prunus persica] gi|462423829|gb|EMJ28092.1| hypothetical protein PRUPE_ppa016494mg, partial [Prunus persica] Length = 406 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/50 (54%), Positives = 34/50 (68%) Frame = -1 Query: 172 PSFSGVITEKLGRSNYVLWLAQILPWLRGRNLMGFVNGQKPCPSEFILDE 23 P+ VI+ KL R+NY LWL Q++P LR RNL+ FV G P EF+LDE Sbjct: 14 PTLPSVISIKLERNNYPLWLVQMVPLLRSRNLLKFVYGTSSVPLEFLLDE 63 >ref|XP_007206852.1| hypothetical protein PRUPE_ppa027128mg [Prunus persica] gi|462402494|gb|EMJ08051.1| hypothetical protein PRUPE_ppa027128mg [Prunus persica] Length = 153 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/54 (48%), Positives = 36/54 (66%) Frame = -1 Query: 169 SFSGVITEKLGRSNYVLWLAQILPWLRGRNLMGFVNGQKPCPSEFILDEEVKPT 8 + S +T KL R+N+ LWLA+I+P LR NL+ FV+G CP+ F+ D E K T Sbjct: 18 NISNFLTIKLDRTNFPLWLAKIVPLLRSHNLLSFVDGSSICPAAFLTDAEGKLT 71 >gb|AFP55537.1| retrotransposon polyprotein [Rosa rugosa] Length = 1384 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/50 (54%), Positives = 33/50 (66%) Frame = -1 Query: 172 PSFSGVITEKLGRSNYVLWLAQILPWLRGRNLMGFVNGQKPCPSEFILDE 23 PS S +T KL R+NY LWLAQI P L+ R L GFV+G CP F+ D+ Sbjct: 11 PSVSNFLTIKLDRTNYPLWLAQITPILKSRKLWGFVDGTNLCPPCFLKDK 60 >ref|XP_007150263.1| hypothetical protein PHAVU_005G139500g [Phaseolus vulgaris] gi|561023527|gb|ESW22257.1| hypothetical protein PHAVU_005G139500g [Phaseolus vulgaris] Length = 318 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/50 (52%), Positives = 36/50 (72%) Frame = -1 Query: 172 PSFSGVITEKLGRSNYVLWLAQILPWLRGRNLMGFVNGQKPCPSEFILDE 23 PS S VI KL + NY+LW AQILP+LR + L+GF++G P P++ I+ E Sbjct: 4 PSISQVINVKLTQENYLLWSAQILPYLRSQGLVGFMDGSMPPPNQTIVVE 53 >ref|XP_007203799.1| hypothetical protein PRUPE_ppb021461mg [Prunus persica] gi|462399330|gb|EMJ04998.1| hypothetical protein PRUPE_ppb021461mg [Prunus persica] Length = 313 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = -1 Query: 169 SFSGVITEKLGRSNYVLWLAQILPWLRGRNLMGFVNGQKPCPS 41 SF+ V+ KL +NY LWLAQILP LR R+LMG+V+G CPS Sbjct: 27 SFTSVVNIKLDHTNYPLWLAQILPILRSRDLMGYVDGTIVCPS 69