BLASTX nr result
ID: Paeonia24_contig00027190
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00027190 (377 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI35966.3| unnamed protein product [Vitis vinifera] 113 3e-23 ref|XP_004151259.1| PREDICTED: pentatricopeptide repeat-containi... 76 5e-12 gb|AFG65812.1| hypothetical protein 2_9455_01, partial [Pinus ta... 76 5e-12 gb|ABK26521.1| unknown [Picea sitchensis] 76 5e-12 ref|XP_004164425.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 75 7e-12 gb|AFG65809.1| hypothetical protein 2_9455_01, partial [Pinus ta... 75 1e-11 gb|AFG65806.1| hypothetical protein 2_9455_01, partial [Pinus ta... 75 1e-11 gb|AFG65804.1| hypothetical protein 2_9455_01, partial [Pinus ta... 75 1e-11 gb|AFG65800.1| hypothetical protein 2_9455_01, partial [Pinus ta... 75 1e-11 gb|AEW08424.1| hypothetical protein 2_9455_01, partial [Pinus ra... 75 1e-11 gb|AEU08453.1| pentatricopeptide repeat protein [Takakia lepidoz... 74 2e-11 gb|ACE80804.1| pentatricopeptide repeat protein [Cycas revoluta] 74 2e-11 ref|XP_004487896.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 gb|AEB39781.1| pentatricopeptide repeat protein 79 [Funaria hygr... 74 3e-11 gb|EMT12987.1| hypothetical protein F775_06874 [Aegilops tauschii] 73 4e-11 emb|CBI28140.3| unnamed protein product [Vitis vinifera] 73 4e-11 gb|ACE80848.1| pentatricopeptide repeat protein [Lepidogyna hodg... 73 4e-11 ref|XP_002281711.1| PREDICTED: pentatricopeptide repeat-containi... 73 4e-11 emb|CAN68552.1| hypothetical protein VITISV_014227 [Vitis vinifera] 73 4e-11 dbj|BAC83258.1| pentatricopeptide (PPR) repeat-containing protei... 73 5e-11 >emb|CBI35966.3| unnamed protein product [Vitis vinifera] Length = 624 Score = 113 bits (282), Expect = 3e-23 Identities = 52/72 (72%), Positives = 60/72 (83%) Frame = -3 Query: 375 RLRRLVKEKRIKKPSGCSWIEVGGAVHRFVVEDTSHAKSREIYEAYQILVNHLKLEGYVP 196 R+RR VKEKRIKKPSGCSW+EV G VHRFVVEDT+H KS EIY AY+ILVNHLK EGYV Sbjct: 553 RVRRQVKEKRIKKPSGCSWVEVDGVVHRFVVEDTTHLKSGEIYGAYEILVNHLKAEGYVA 612 Query: 195 NVEFVLKNIDSL 160 N +F+ NI+ + Sbjct: 613 NFDFIANNINGM 624 >ref|XP_004151259.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic-like [Cucumis sativus] Length = 849 Score = 75.9 bits (185), Expect = 5e-12 Identities = 34/69 (49%), Positives = 49/69 (71%) Frame = -3 Query: 372 LRRLVKEKRIKKPSGCSWIEVGGAVHRFVVEDTSHAKSREIYEAYQILVNHLKLEGYVPN 193 +R+ +KEK + K +GCSW+EV VH+F V DTSH K+ EIY+ Q L +K GYVPN Sbjct: 702 IRKAMKEKNLIKEAGCSWVEVENKVHKFYVGDTSHPKAAEIYDELQNLSVKIKKLGYVPN 761 Query: 192 VEFVLKNID 166 ++FVL +++ Sbjct: 762 LDFVLHDVE 770 >gb|AFG65812.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gi|383165818|gb|AFG65813.1| hypothetical protein 2_9455_01, partial [Pinus taeda] Length = 156 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/69 (47%), Positives = 47/69 (68%) Frame = -3 Query: 372 LRRLVKEKRIKKPSGCSWIEVGGAVHRFVVEDTSHAKSREIYEAYQILVNHLKLEGYVPN 193 +RR++KEK +KK GCSWIEV +H FVV DTSH ++ EIY L +K GY+P+ Sbjct: 9 VRRMMKEKGLKKQPGCSWIEVNNKMHSFVVGDTSHPQTEEIYTLLDALAGQMKEAGYLPD 68 Query: 192 VEFVLKNID 166 +FVL +++ Sbjct: 69 TDFVLHDVE 77 >gb|ABK26521.1| unknown [Picea sitchensis] Length = 370 Score = 75.9 bits (185), Expect = 5e-12 Identities = 31/70 (44%), Positives = 48/70 (68%) Frame = -3 Query: 375 RLRRLVKEKRIKKPSGCSWIEVGGAVHRFVVEDTSHAKSREIYEAYQILVNHLKLEGYVP 196 ++R+++K++ +KK GCSWIEV VH F+V D+SH + EIYE + L +K GY+P Sbjct: 222 KVRKMMKDRSVKKEPGCSWIEVQNKVHPFIVGDSSHPQIEEIYETLETLTLQMKAAGYIP 281 Query: 195 NVEFVLKNID 166 N FVL +++ Sbjct: 282 NTNFVLHDVE 291 >ref|XP_004164425.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g49170, chloroplastic-like [Cucumis sativus] Length = 849 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/69 (49%), Positives = 49/69 (71%) Frame = -3 Query: 372 LRRLVKEKRIKKPSGCSWIEVGGAVHRFVVEDTSHAKSREIYEAYQILVNHLKLEGYVPN 193 +R+ +KEK + K +GCSW+EV VH+F V DTSH K+ EIY+ Q L +K GYVPN Sbjct: 702 IRKAMKEKXLIKEAGCSWVEVENKVHKFYVGDTSHPKAAEIYDELQNLSVKIKKLGYVPN 761 Query: 192 VEFVLKNID 166 ++FVL +++ Sbjct: 762 LDFVLHDVE 770 >gb|AFG65809.1| hypothetical protein 2_9455_01, partial [Pinus taeda] Length = 156 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/69 (46%), Positives = 47/69 (68%) Frame = -3 Query: 372 LRRLVKEKRIKKPSGCSWIEVGGAVHRFVVEDTSHAKSREIYEAYQILVNHLKLEGYVPN 193 +RR++K+K +KK GCSWIEV +H FVV DTSH ++ EIY L +K GY+P+ Sbjct: 9 VRRMMKDKGLKKQPGCSWIEVNNKMHSFVVGDTSHPQTEEIYTLLDALAGQMKEAGYLPD 68 Query: 192 VEFVLKNID 166 +FVL +++ Sbjct: 69 TDFVLHDVE 77 >gb|AFG65806.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gi|383165806|gb|AFG65807.1| hypothetical protein 2_9455_01, partial [Pinus taeda] Length = 156 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/69 (46%), Positives = 47/69 (68%) Frame = -3 Query: 372 LRRLVKEKRIKKPSGCSWIEVGGAVHRFVVEDTSHAKSREIYEAYQILVNHLKLEGYVPN 193 +RR++K+K +KK GCSWIEV +H FVV DTSH ++ EIY L +K GY+P+ Sbjct: 9 VRRMMKDKGLKKQPGCSWIEVNNKMHSFVVGDTSHPQTEEIYTLLDALAGQMKEAGYLPD 68 Query: 192 VEFVLKNID 166 +FVL +++ Sbjct: 69 TDFVLHDVE 77 >gb|AFG65804.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gi|383165802|gb|AFG65805.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gi|383165820|gb|AFG65814.1| hypothetical protein 2_9455_01, partial [Pinus taeda] Length = 156 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/69 (46%), Positives = 47/69 (68%) Frame = -3 Query: 372 LRRLVKEKRIKKPSGCSWIEVGGAVHRFVVEDTSHAKSREIYEAYQILVNHLKLEGYVPN 193 +RR++K+K +KK GCSWIEV +H FVV DTSH ++ EIY L +K GY+P+ Sbjct: 9 VRRMMKDKGLKKQPGCSWIEVNNKMHSFVVGDTSHPQTEEIYTLLDALAGQMKEAGYLPD 68 Query: 192 VEFVLKNID 166 +FVL +++ Sbjct: 69 TDFVLHDVE 77 >gb|AFG65800.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gi|383165796|gb|AFG65802.1| hypothetical protein 2_9455_01, partial [Pinus taeda] Length = 156 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/69 (46%), Positives = 47/69 (68%) Frame = -3 Query: 372 LRRLVKEKRIKKPSGCSWIEVGGAVHRFVVEDTSHAKSREIYEAYQILVNHLKLEGYVPN 193 +RR++K+K +KK GCSWIEV +H FVV DTSH ++ EIY L +K GY+P+ Sbjct: 9 VRRMMKDKGLKKQPGCSWIEVNNKMHSFVVGDTSHPQTEEIYTLLDALAGQMKEAGYLPD 68 Query: 192 VEFVLKNID 166 +FVL +++ Sbjct: 69 TDFVLHDVE 77 >gb|AEW08424.1| hypothetical protein 2_9455_01, partial [Pinus radiata] gi|383165794|gb|AFG65801.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gi|383165798|gb|AFG65803.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gi|383165808|gb|AFG65808.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gi|383165812|gb|AFG65810.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gi|383165814|gb|AFG65811.1| hypothetical protein 2_9455_01, partial [Pinus taeda] Length = 156 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/69 (46%), Positives = 47/69 (68%) Frame = -3 Query: 372 LRRLVKEKRIKKPSGCSWIEVGGAVHRFVVEDTSHAKSREIYEAYQILVNHLKLEGYVPN 193 +RR++K+K +KK GCSWIEV +H FVV DTSH ++ EIY L +K GY+P+ Sbjct: 9 VRRMMKDKGLKKQPGCSWIEVNNKMHSFVVGDTSHPQTEEIYTLLDALAGQMKEAGYLPD 68 Query: 192 VEFVLKNID 166 +FVL +++ Sbjct: 69 TDFVLHDVE 77 >gb|AEU08453.1| pentatricopeptide repeat protein [Takakia lepidozioides] Length = 152 Score = 74.3 bits (181), Expect = 2e-11 Identities = 29/70 (41%), Positives = 50/70 (71%) Frame = -3 Query: 375 RLRRLVKEKRIKKPSGCSWIEVGGAVHRFVVEDTSHAKSREIYEAYQILVNHLKLEGYVP 196 ++ ++++E+ +K+ GCSWIEV VH F+V+D SH ++ EIY + L +H+K EGY+P Sbjct: 11 KVGKVMEERGVKREPGCSWIEVRKRVHSFIVDDRSHPQTEEIYAELEKLTSHMKEEGYIP 70 Query: 195 NVEFVLKNID 166 + F+L ++D Sbjct: 71 DTRFILHDVD 80 >gb|ACE80804.1| pentatricopeptide repeat protein [Cycas revoluta] Length = 152 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/70 (45%), Positives = 49/70 (70%) Frame = -3 Query: 375 RLRRLVKEKRIKKPSGCSWIEVGGAVHRFVVEDTSHAKSREIYEAYQILVNHLKLEGYVP 196 ++R+L+ E+R+KK GCSWIEV VH F+V DTSH ++++IY + L +K GY+P Sbjct: 11 KVRKLMTERRVKKIPGCSWIEVNNKVHAFLVGDTSHPQAQKIYAELERLSGQMKEGGYLP 70 Query: 195 NVEFVLKNID 166 N FVL +++ Sbjct: 71 NTNFVLHDVE 80 >ref|XP_004487896.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like isoform X1 [Cicer arietinum] gi|502085351|ref|XP_004487897.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like isoform X2 [Cicer arietinum] Length = 872 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/69 (46%), Positives = 47/69 (68%) Frame = -3 Query: 372 LRRLVKEKRIKKPSGCSWIEVGGAVHRFVVEDTSHAKSREIYEAYQILVNHLKLEGYVPN 193 +R+ +KE ++K GCSWIE G VH+F+ DTSH +S+E++E + L +K EGYVP+ Sbjct: 725 VRKKMKEMGVRKEPGCSWIEHGDEVHKFLAGDTSHPQSKELHEYLETLSQRMKKEGYVPD 784 Query: 192 VEFVLKNID 166 VL N+D Sbjct: 785 TSCVLHNVD 793 >gb|AEB39781.1| pentatricopeptide repeat protein 79 [Funaria hygrometrica] Length = 820 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/70 (47%), Positives = 46/70 (65%) Frame = -3 Query: 375 RLRRLVKEKRIKKPSGCSWIEVGGAVHRFVVEDTSHAKSREIYEAYQILVNHLKLEGYVP 196 +LR+L+KE+ +KK G SWIEV G VH FV D SH ++ EIY + L +K GYVP Sbjct: 672 KLRKLMKERGVKKEPGRSWIEVAGEVHSFVAGDQSHPRTEEIYSELEALTKQIKSLGYVP 731 Query: 195 NVEFVLKNID 166 + FV+ ++D Sbjct: 732 DTRFVMHDLD 741 >gb|EMT12987.1| hypothetical protein F775_06874 [Aegilops tauschii] Length = 680 Score = 73.2 bits (178), Expect = 4e-11 Identities = 31/71 (43%), Positives = 52/71 (73%) Frame = -3 Query: 375 RLRRLVKEKRIKKPSGCSWIEVGGAVHRFVVEDTSHAKSREIYEAYQILVNHLKLEGYVP 196 R+R+L++++ +KK GCSWIEVG VH FVV DT H ++ E+Y+ +++ ++ GYVP Sbjct: 528 RVRKLMRDRGVKKEPGCSWIEVGNKVHVFVVGDTKHPEAHEVYKFLEMIGAKMRKLGYVP 587 Query: 195 NVEFVLKNIDS 163 + +FVL+++ S Sbjct: 588 DTKFVLQDMAS 598 >emb|CBI28140.3| unnamed protein product [Vitis vinifera] Length = 580 Score = 73.2 bits (178), Expect = 4e-11 Identities = 36/70 (51%), Positives = 46/70 (65%) Frame = -3 Query: 375 RLRRLVKEKRIKKPSGCSWIEVGGAVHRFVVEDTSHAKSREIYEAYQILVNHLKLEGYVP 196 ++R L+ E+ IKKP GCS IEVGG VH FV D SH +S EIYE ++ LK GYVP Sbjct: 432 KMRELMVERNIKKPPGCSAIEVGGVVHEFVKGDVSHPQSSEIYETLDDMMRRLKSAGYVP 491 Query: 195 NVEFVLKNID 166 + VL ++D Sbjct: 492 DKSEVLFDMD 501 >gb|ACE80848.1| pentatricopeptide repeat protein [Lepidogyna hodgsoniae] Length = 152 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/69 (47%), Positives = 48/69 (69%) Frame = -3 Query: 372 LRRLVKEKRIKKPSGCSWIEVGGAVHRFVVEDTSHAKSREIYEAYQILVNHLKLEGYVPN 193 +R +++E+ ++K G SWIEV +H FVV DTSH ++ EIY + L +LK EGYVP+ Sbjct: 12 VRTVMQERGVRKEPGRSWIEVDNKIHEFVVADTSHPEAAEIYTVLKKLTENLKAEGYVPD 71 Query: 192 VEFVLKNID 166 + VL+NID Sbjct: 72 TKLVLQNID 80 >ref|XP_002281711.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic [Vitis vinifera] Length = 711 Score = 73.2 bits (178), Expect = 4e-11 Identities = 36/70 (51%), Positives = 46/70 (65%) Frame = -3 Query: 375 RLRRLVKEKRIKKPSGCSWIEVGGAVHRFVVEDTSHAKSREIYEAYQILVNHLKLEGYVP 196 ++R L+ E+ IKKP GCS IEVGG VH FV D SH +S EIYE ++ LK GYVP Sbjct: 563 KMRELMVERNIKKPPGCSAIEVGGVVHEFVKGDVSHPQSSEIYETLDDMMRRLKSAGYVP 622 Query: 195 NVEFVLKNID 166 + VL ++D Sbjct: 623 DKSEVLFDMD 632 >emb|CAN68552.1| hypothetical protein VITISV_014227 [Vitis vinifera] Length = 1309 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/70 (47%), Positives = 49/70 (70%) Frame = -3 Query: 375 RLRRLVKEKRIKKPSGCSWIEVGGAVHRFVVEDTSHAKSREIYEAYQILVNHLKLEGYVP 196 ++R L+ ++R+KK G +WIEV H+F V DT+H +S+EIYE + L N L+L GYVP Sbjct: 485 KIRDLMSQRRLKKTPGWTWIEVDNKSHQFSVGDTTHPRSKEIYEMLKSLSNKLELVGYVP 544 Query: 195 NVEFVLKNID 166 + FVL ++D Sbjct: 545 DTNFVLHDVD 554 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/70 (47%), Positives = 49/70 (70%) Frame = -3 Query: 375 RLRRLVKEKRIKKPSGCSWIEVGGAVHRFVVEDTSHAKSREIYEAYQILVNHLKLEGYVP 196 ++R L+ ++R+KK G +WIEV H+F V DT+H +S+EIYE + L N L+L GYVP Sbjct: 1161 KIRDLMSQRRLKKIPGWTWIEVDNKSHQFSVGDTTHPRSKEIYEMLKSLGNKLELVGYVP 1220 Query: 195 NVEFVLKNID 166 + FVL ++D Sbjct: 1221 DTNFVLHDVD 1230 >dbj|BAC83258.1| pentatricopeptide (PPR) repeat-containing protein-like protein [Oryza sativa Japonica Group] gi|50509373|dbj|BAD30928.1| pentatricopeptide (PPR) repeat-containing protein-like protein [Oryza sativa Japonica Group] Length = 808 Score = 72.8 bits (177), Expect = 5e-11 Identities = 28/70 (40%), Positives = 52/70 (74%) Frame = -3 Query: 375 RLRRLVKEKRIKKPSGCSWIEVGGAVHRFVVEDTSHAKSREIYEAYQILVNHLKLEGYVP 196 R+R+L++++ +KK GCSWIEVG +H F+V DT H +++E+Y+ +++ ++ GYVP Sbjct: 660 RVRKLMRDRGVKKEPGCSWIEVGSKIHVFLVGDTKHPEAQEVYQFLEVIGARMRKLGYVP 719 Query: 195 NVEFVLKNID 166 + +FVL +++ Sbjct: 720 DTKFVLHDME 729