BLASTX nr result
ID: Paeonia24_contig00027016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00027016 (304 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516590.1| pentatricopeptide repeat-containing protein,... 54 2e-07 ref|XP_004292867.1| PREDICTED: pentatricopeptide repeat-containi... 52 2e-07 ref|XP_007227273.1| hypothetical protein PRUPE_ppa017736mg [Prun... 52 6e-07 ref|XP_006450596.1| hypothetical protein CICLE_v10010742mg [Citr... 49 2e-06 ref|XP_006476161.1| PREDICTED: pentatricopeptide repeat-containi... 49 2e-06 ref|XP_006481440.1| PREDICTED: pentatricopeptide repeat-containi... 49 2e-06 ref|XP_002282081.2| PREDICTED: pentatricopeptide repeat-containi... 47 3e-06 ref|XP_006360941.1| PREDICTED: pentatricopeptide repeat-containi... 48 3e-06 ref|XP_004247963.1| PREDICTED: pentatricopeptide repeat-containi... 48 3e-06 emb|CBI20961.3| unnamed protein product [Vitis vinifera] 47 3e-06 ref|XP_002282128.1| PREDICTED: pentatricopeptide repeat-containi... 47 3e-06 gb|EXC32781.1| hypothetical protein L484_019895 [Morus notabilis] 50 4e-06 >ref|XP_002516590.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223544410|gb|EEF45931.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 517 Score = 53.5 bits (127), Expect(3) = 2e-07 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -3 Query: 302 TFCNLQVAVTIMENLIEFEPDDTGNYALLSNIY 204 T CN++VAV ME+L E EPDDTGNY LLSNIY Sbjct: 408 THCNIEVAVIAMEHLEELEPDDTGNYVLLSNIY 440 Score = 23.5 bits (49), Expect(3) = 2e-07 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 192 LESKSTKKTLGCSVIE 145 + SK KKT GCS+IE Sbjct: 456 VRSKRMKKTPGCSLIE 471 Score = 23.1 bits (48), Expect(3) = 2e-07 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -1 Query: 136 EFIVSDDSKPFSE 98 EF+ DDSKP+S+ Sbjct: 478 EFVSGDDSKPYSK 490 >ref|XP_004292867.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like [Fragaria vesca subsp. vesca] Length = 544 Score = 52.0 bits (123), Expect(3) = 2e-07 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = -3 Query: 302 TFCNLQVAVTIMENLIEFEPDDTGNYALLSNIY 204 TFCNL++A+ ME L + EPDD GNY LLSNIY Sbjct: 430 TFCNLEIALIAMEQLQDLEPDDAGNYVLLSNIY 462 Score = 25.8 bits (55), Expect(3) = 2e-07 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 192 LESKSTKKTLGCSVIE 145 + SKS KKT GCS+IE Sbjct: 478 IRSKSMKKTPGCSLIE 493 Score = 21.9 bits (45), Expect(3) = 2e-07 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = -1 Query: 136 EFIVSDDSKPFSE 98 EF+ DD+KPF++ Sbjct: 500 EFVSGDDTKPFAK 512 >ref|XP_007227273.1| hypothetical protein PRUPE_ppa017736mg [Prunus persica] gi|462424209|gb|EMJ28472.1| hypothetical protein PRUPE_ppa017736mg [Prunus persica] Length = 544 Score = 51.6 bits (122), Expect(3) = 6e-07 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = -3 Query: 302 TFCNLQVAVTIMENLIEFEPDDTGNYALLSNIY 204 T CNL++A+T ME+L EPDD GNY LLSNIY Sbjct: 430 THCNLEIAITAMEHLSVLEPDDAGNYVLLSNIY 462 Score = 24.6 bits (52), Expect(3) = 6e-07 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -2 Query: 192 LESKSTKKTLGCSVIE 145 + SKS K+T GCS+IE Sbjct: 478 IRSKSMKRTPGCSLIE 493 Score = 21.9 bits (45), Expect(3) = 6e-07 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -1 Query: 136 EFIVSDDSKPFSEPPPFQPSDFLVFFHH 53 EF+ +DSKPF++ F + LV H+ Sbjct: 500 EFVSGNDSKPFAK-DIFSMLELLVLQHN 526 >ref|XP_006450596.1| hypothetical protein CICLE_v10010742mg [Citrus clementina] gi|557553822|gb|ESR63836.1| hypothetical protein CICLE_v10010742mg [Citrus clementina] Length = 605 Score = 49.3 bits (116), Expect(3) = 2e-06 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = -3 Query: 302 TFCNLQVAVTIMENLIEFEPDDTGNYALLSNIY 204 T+ NL++AV ME+L+ EP+DTGNY LLSNIY Sbjct: 430 TYSNLEIAVIAMEHLLVLEPEDTGNYVLLSNIY 462 Score = 25.8 bits (55), Expect(3) = 2e-06 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 192 LESKSTKKTLGCSVIE 145 + SKS KKT GCS+IE Sbjct: 478 IRSKSMKKTPGCSLIE 493 Score = 21.2 bits (43), Expect(3) = 2e-06 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -1 Query: 136 EFIVSDDSKPF 104 EF+ DD+KPF Sbjct: 500 EFVSGDDTKPF 510 >ref|XP_006476161.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like [Citrus sinensis] Length = 541 Score = 49.3 bits (116), Expect(3) = 2e-06 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = -3 Query: 302 TFCNLQVAVTIMENLIEFEPDDTGNYALLSNIY 204 T+ NL++AV ME+L+ EP+DTGNY LLSNIY Sbjct: 430 TYSNLEIAVIAMEHLLVLEPEDTGNYVLLSNIY 462 Score = 25.8 bits (55), Expect(3) = 2e-06 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 192 LESKSTKKTLGCSVIE 145 + SKS KKT GCS+IE Sbjct: 478 IRSKSMKKTPGCSLIE 493 Score = 21.2 bits (43), Expect(3) = 2e-06 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -1 Query: 136 EFIVSDDSKPF 104 EF+ DD+KPF Sbjct: 500 EFVSGDDTKPF 510 >ref|XP_006481440.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like, partial [Citrus sinensis] Length = 436 Score = 49.3 bits (116), Expect(3) = 2e-06 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = -3 Query: 302 TFCNLQVAVTIMENLIEFEPDDTGNYALLSNIY 204 T+ NL++AV ME+L+ EP+DTGNY LLSNIY Sbjct: 325 TYSNLEIAVIAMEHLLVLEPEDTGNYVLLSNIY 357 Score = 25.8 bits (55), Expect(3) = 2e-06 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 192 LESKSTKKTLGCSVIE 145 + SKS KKT GCS+IE Sbjct: 373 IRSKSMKKTPGCSLIE 388 Score = 21.2 bits (43), Expect(3) = 2e-06 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -1 Query: 136 EFIVSDDSKPF 104 EF+ DD+KPF Sbjct: 395 EFVSGDDTKPF 405 >ref|XP_002282081.2| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like [Vitis vinifera] Length = 541 Score = 47.0 bits (110), Expect(3) = 3e-06 Identities = 20/30 (66%), Positives = 25/30 (83%) Frame = -3 Query: 293 NLQVAVTIMENLIEFEPDDTGNYALLSNIY 204 NL++AV ME+L+E EP DTGNY LLSN+Y Sbjct: 433 NLEIAVIAMEHLLELEPADTGNYVLLSNLY 462 Score = 26.2 bits (56), Expect(3) = 3e-06 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 192 LESKSTKKTLGCSVIEED 139 + SKS KKT GCS IE D Sbjct: 478 MRSKSMKKTPGCSSIEVD 495 Score = 22.7 bits (47), Expect(3) = 3e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 136 EFIVSDDSKPFSE 98 EF DDSKPFS+ Sbjct: 500 EFASGDDSKPFSK 512 >ref|XP_006360941.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like [Solanum tuberosum] Length = 536 Score = 48.1 bits (113), Expect(3) = 3e-06 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = -3 Query: 302 TFCNLQVAVTIMENLIEFEPDDTGNYALLSNIY 204 T NL++AV ME+L+E EP+DTGNY LL+NIY Sbjct: 425 THRNLEIAVIAMEHLLELEPEDTGNYILLANIY 457 Score = 25.8 bits (55), Expect(3) = 3e-06 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 192 LESKSTKKTLGCSVIE 145 + SKS KKT GCS+IE Sbjct: 473 IRSKSMKKTPGCSLIE 488 Score = 21.9 bits (45), Expect(3) = 3e-06 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -1 Query: 136 EFIVSDDSKPFSE 98 EF+ D+SKPFS+ Sbjct: 495 EFLSGDNSKPFSK 507 >ref|XP_004247963.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like [Solanum lycopersicum] Length = 534 Score = 48.1 bits (113), Expect(3) = 3e-06 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = -3 Query: 302 TFCNLQVAVTIMENLIEFEPDDTGNYALLSNIY 204 T NL++AV ME+L+E EP+DTGNY LL+NIY Sbjct: 423 THRNLEIAVIAMEHLLELEPEDTGNYILLANIY 455 Score = 25.8 bits (55), Expect(3) = 3e-06 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 192 LESKSTKKTLGCSVIE 145 + SKS KKT GCS+IE Sbjct: 471 IRSKSMKKTPGCSLIE 486 Score = 21.9 bits (45), Expect(3) = 3e-06 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -1 Query: 136 EFIVSDDSKPFSE 98 EF+ D+SKPFS+ Sbjct: 493 EFLSGDNSKPFSK 505 >emb|CBI20961.3| unnamed protein product [Vitis vinifera] Length = 553 Score = 46.6 bits (109), Expect(3) = 3e-06 Identities = 20/30 (66%), Positives = 25/30 (83%) Frame = -3 Query: 293 NLQVAVTIMENLIEFEPDDTGNYALLSNIY 204 NL++AV ME+L+E EP DTGNY LLSN+Y Sbjct: 449 NLKIAVIAMEHLLELEPADTGNYVLLSNLY 478 Score = 26.2 bits (56), Expect(3) = 3e-06 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 192 LESKSTKKTLGCSVIEED 139 + SKS KKT GCS IE D Sbjct: 494 MRSKSMKKTPGCSSIEVD 511 Score = 22.7 bits (47), Expect(3) = 3e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 136 EFIVSDDSKPFSE 98 EF DDSKPFS+ Sbjct: 516 EFASGDDSKPFSK 528 >ref|XP_002282128.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540 [Vitis vinifera] Length = 537 Score = 46.6 bits (109), Expect(3) = 3e-06 Identities = 20/30 (66%), Positives = 25/30 (83%) Frame = -3 Query: 293 NLQVAVTIMENLIEFEPDDTGNYALLSNIY 204 NL++AV ME+L+E EP DTGNY LLSN+Y Sbjct: 433 NLKIAVIAMEHLLELEPADTGNYVLLSNLY 462 Score = 26.2 bits (56), Expect(3) = 3e-06 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 192 LESKSTKKTLGCSVIEED 139 + SKS KKT GCS IE D Sbjct: 478 MRSKSMKKTPGCSSIEVD 495 Score = 22.7 bits (47), Expect(3) = 3e-06 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 136 EFIVSDDSKPFSE 98 EF DDSKPFS+ Sbjct: 500 EFASGDDSKPFSK 512 >gb|EXC32781.1| hypothetical protein L484_019895 [Morus notabilis] Length = 549 Score = 50.4 bits (119), Expect(2) = 4e-06 Identities = 19/31 (61%), Positives = 26/31 (83%) Frame = -3 Query: 296 CNLQVAVTIMENLIEFEPDDTGNYALLSNIY 204 CN+++A+ ME+L+E EPDD GNY LLSN+Y Sbjct: 434 CNVEIAIVAMEHLLEIEPDDIGNYVLLSNVY 464 Score = 25.8 bits (55), Expect(2) = 4e-06 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 192 LESKSTKKTLGCSVIE 145 + SKS KKT GCS+IE Sbjct: 480 IRSKSMKKTPGCSLIE 495