BLASTX nr result
ID: Paeonia24_contig00026720
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00026720 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN70077.1| hypothetical protein VITISV_009399 [Vitis vinifera] 57 3e-06 >emb|CAN70077.1| hypothetical protein VITISV_009399 [Vitis vinifera] Length = 613 Score = 57.0 bits (136), Expect = 3e-06 Identities = 37/97 (38%), Positives = 46/97 (47%) Frame = +1 Query: 22 TFNAKAEPGEWSRRISVGLHHSVIPLASSHDHVDEERTKPYTSLGRKIKEGNLTWPKDAK 201 TFN+K V L + V+ L SSH E + + LG + G W K Sbjct: 44 TFNSKLN--------KVKLVYDVLLLNSSHPTTIEVHDE-FGLLGSHVCNGKAKWGSSFK 94 Query: 202 IFQDVPFIKKYWEWTEDVLSRFRKNLKDAGLYEAIYA 312 +F + FIK YWEW E VL R LK LYEAI+A Sbjct: 95 VFGESFFIKGYWEWVEGVLGRHEPFLKGCKLYEAIFA 131