BLASTX nr result
ID: Paeonia24_contig00026661
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00026661 (253 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002299986.1| hypothetical protein POPTR_0001s28400g [Popu... 74 2e-11 gb|ABK93346.1| unknown [Populus trichocarpa] 74 2e-11 ref|XP_006364536.1| PREDICTED: F-box protein SKIP23-like [Solanu... 62 6e-08 ref|XP_004231072.1| PREDICTED: F-box protein SKIP23-like [Solanu... 62 6e-08 ref|XP_002521669.1| sugar binding protein, putative [Ricinus com... 61 1e-07 ref|XP_002278547.2| PREDICTED: F-box protein SKIP23-like [Vitis ... 60 3e-07 ref|XP_002300676.1| hypothetical protein POPTR_0002s01710g [Popu... 59 9e-07 emb|CAN66619.1| hypothetical protein VITISV_028369 [Vitis vinifera] 59 9e-07 ref|XP_006383015.1| F-box family protein [Populus trichocarpa] g... 58 2e-06 ref|XP_002305539.2| hypothetical protein POPTR_0004s18630g [Popu... 57 2e-06 ref|XP_004149495.1| PREDICTED: putative F-box protein At1g65770-... 57 3e-06 ref|XP_002510609.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 ref|XP_002510608.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 ref|XP_003591727.1| F-box protein [Medicago truncatula] gi|35834... 56 6e-06 >ref|XP_002299986.1| hypothetical protein POPTR_0001s28400g [Populus trichocarpa] gi|222847244|gb|EEE84791.1| hypothetical protein POPTR_0001s28400g [Populus trichocarpa] Length = 402 Score = 73.9 bits (180), Expect = 2e-11 Identities = 41/78 (52%), Positives = 48/78 (61%), Gaps = 2/78 (2%) Frame = +3 Query: 24 MDSISA-QWSQLPKELLETITKHIDSCTDLPFVRAVCKPWRSSLPPSPHNSQRLPIINLP 200 MDS S QWS LP +LL I + + DL +RAVC WRSSL P + P++ LP Sbjct: 1 MDSTSPPQWSSLPSDLLFNIASILGTRIDLLSLRAVCNSWRSSLSLPP----KTPLVKLP 56 Query: 201 FPIGP-NPNLNPKRRGHF 251 FPI P NPNLNP R GHF Sbjct: 57 FPIDPNNPNLNPNRHGHF 74 >gb|ABK93346.1| unknown [Populus trichocarpa] Length = 231 Score = 73.9 bits (180), Expect = 2e-11 Identities = 41/78 (52%), Positives = 48/78 (61%), Gaps = 2/78 (2%) Frame = +3 Query: 24 MDSISA-QWSQLPKELLETITKHIDSCTDLPFVRAVCKPWRSSLPPSPHNSQRLPIINLP 200 MDS S QWS LP +LL I + + DL +RAVC WRSSL P + P++ LP Sbjct: 1 MDSTSPPQWSSLPSDLLFNIASILGTRIDLLSLRAVCNSWRSSLSLPP----KTPLVKLP 56 Query: 201 FPIGP-NPNLNPKRRGHF 251 FPI P NPNLNP R GHF Sbjct: 57 FPIDPNNPNLNPNRHGHF 74 >ref|XP_006364536.1| PREDICTED: F-box protein SKIP23-like [Solanum tuberosum] Length = 456 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/53 (54%), Positives = 38/53 (71%), Gaps = 2/53 (3%) Frame = +3 Query: 39 AQWSQLPKELLETITKHIDSCTDLPFVRAVCKPWRSSLPPSPHNS--QRLPII 191 A+WSQLP+EL+E I+KH+ + TD R+VC WRSSLPP P+ S R PI+ Sbjct: 2 AEWSQLPRELVELISKHLSTETDFLRFRSVCSSWRSSLPPKPYPSSLSRFPIL 54 >ref|XP_004231072.1| PREDICTED: F-box protein SKIP23-like [Solanum lycopersicum] Length = 406 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/53 (54%), Positives = 38/53 (71%), Gaps = 2/53 (3%) Frame = +3 Query: 39 AQWSQLPKELLETITKHIDSCTDLPFVRAVCKPWRSSLPPSPHNS--QRLPII 191 A+WSQLP+EL+E I+KH+ + TD R+VC WRSSLPP P+ S R PI+ Sbjct: 2 AEWSQLPRELVELISKHLSTETDFLRFRSVCSSWRSSLPPKPYPSSLSRFPIL 54 >ref|XP_002521669.1| sugar binding protein, putative [Ricinus communis] gi|223539060|gb|EEF40656.1| sugar binding protein, putative [Ricinus communis] Length = 387 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 1/62 (1%) Frame = +3 Query: 24 MDSISAQWSQLPKELLETITKHIDSCTDLPFVRAVCKPWRSSLP-PSPHNSQRLPIINLP 200 M I QW+ LPKEL+E I++H+DS D+ +RAVC WRSS+ PS L I++LP Sbjct: 1 MGDIRRQWADLPKELVEMISEHLDSLIDILQLRAVCTSWRSSVSLPSFDQEIPLQILSLP 60 Query: 201 FP 206 FP Sbjct: 61 FP 62 >ref|XP_002278547.2| PREDICTED: F-box protein SKIP23-like [Vitis vinifera] Length = 405 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/69 (42%), Positives = 38/69 (55%) Frame = +3 Query: 24 MDSISAQWSQLPKELLETITKHIDSCTDLPFVRAVCKPWRSSLPPSPHNSQRLPIINLPF 203 MDS + QWS LPK+LL I +D+ D R VC W SS+ P+ + + LP+ Sbjct: 1 MDSDAGQWSHLPKDLLAKIAGRLDTRIDFLHFRGVCSSWMSSVSPTFPRKNPILSLKLPY 60 Query: 204 PIGPNPNLN 230 PI N NLN Sbjct: 61 PIASNANLN 69 >ref|XP_002300676.1| hypothetical protein POPTR_0002s01710g [Populus trichocarpa] gi|222842402|gb|EEE79949.1| hypothetical protein POPTR_0002s01710g [Populus trichocarpa] Length = 305 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/71 (42%), Positives = 42/71 (59%) Frame = +3 Query: 39 AQWSQLPKELLETITKHIDSCTDLPFVRAVCKPWRSSLPPSPHNSQRLPIINLPFPIGPN 218 ++WS LP ELL+ IT+ + D VRAVCK WRS+LP PH+ + LP+ + P Sbjct: 2 SRWSDLPPELLQLITQKQTNYVDYLCVRAVCKSWRSALPKKPHDL----LCQLPWLLLPY 57 Query: 219 PNLNPKRRGHF 251 N +P RG + Sbjct: 58 QNDSPNHRGFY 68 >emb|CAN66619.1| hypothetical protein VITISV_028369 [Vitis vinifera] Length = 986 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/69 (42%), Positives = 38/69 (55%) Frame = +3 Query: 24 MDSISAQWSQLPKELLETITKHIDSCTDLPFVRAVCKPWRSSLPPSPHNSQRLPIINLPF 203 M S + QWS LPK+LL I +D+ D R VC W SS+ P+ + L + LP+ Sbjct: 1 MXSDAGQWSHLPKDLLAKIAGRLDTRIDFLHFRGVCSSWMSSVSPTFPSKNPLLSLKLPY 60 Query: 204 PIGPNPNLN 230 PI N NLN Sbjct: 61 PIASNANLN 69 >ref|XP_006383015.1| F-box family protein [Populus trichocarpa] gi|550338590|gb|ERP60812.1| F-box family protein [Populus trichocarpa] Length = 389 Score = 57.8 bits (138), Expect = 2e-06 Identities = 33/64 (51%), Positives = 39/64 (60%), Gaps = 2/64 (3%) Frame = +3 Query: 36 SAQWSQLPKELLETITKHIDSCTDLPFVRAVCKPWRSSLPPSPHNSQRLP--IINLPFPI 209 S QW+ LPKELLE I K +DS D RAVC WRSS+ P + Q +P I+NLP PI Sbjct: 3 SIQWADLPKELLEMIGKRLDSRVDTLRFRAVCTSWRSSV-SLPSSDQEIPPLILNLPGPI 61 Query: 210 GPNP 221 P Sbjct: 62 SYAP 65 >ref|XP_002305539.2| hypothetical protein POPTR_0004s18630g [Populus trichocarpa] gi|566167272|ref|XP_006384594.1| hypothetical protein POPTR_0004s18630g [Populus trichocarpa] gi|550341338|gb|EEE86050.2| hypothetical protein POPTR_0004s18630g [Populus trichocarpa] gi|550341339|gb|ERP62391.1| hypothetical protein POPTR_0004s18630g [Populus trichocarpa] Length = 410 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/42 (54%), Positives = 32/42 (76%) Frame = +3 Query: 39 AQWSQLPKELLETITKHIDSCTDLPFVRAVCKPWRSSLPPSP 164 A+W+ LPK+L+E I+K +D+ TDL R+VC WRSS+PP P Sbjct: 2 AEWTHLPKDLMELISKRLDTSTDLLRFRSVCNSWRSSIPPEP 43 >ref|XP_004149495.1| PREDICTED: putative F-box protein At1g65770-like [Cucumis sativus] gi|449523824|ref|XP_004168923.1| PREDICTED: putative F-box protein At1g65770-like [Cucumis sativus] Length = 429 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/70 (41%), Positives = 40/70 (57%) Frame = +3 Query: 24 MDSISAQWSQLPKELLETITKHIDSCTDLPFVRAVCKPWRSSLPPSPHNSQRLPIINLPF 203 MD WS+LP E+ + KH+ + D+ R+VC+ WRSSLPP S LP LPF Sbjct: 1 MDDAGVPWSELPPEIWPAVGKHLHNYIDVLRFRSVCRSWRSSLPPFSQTSPPLP---LPF 57 Query: 204 PIGPNPNLNP 233 P+P ++P Sbjct: 58 ---PSPYISP 64 >ref|XP_002510609.1| conserved hypothetical protein [Ricinus communis] gi|223551310|gb|EEF52796.1| conserved hypothetical protein [Ricinus communis] Length = 406 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/71 (39%), Positives = 42/71 (59%) Frame = +3 Query: 39 AQWSQLPKELLETITKHIDSCTDLPFVRAVCKPWRSSLPPSPHNSQRLPIINLPFPIGPN 218 + WS+LP+ELL+TIT+ + D RAVCK W S++P PH+ + LP+ + P+ Sbjct: 2 SSWSELPQELLQTITQKQTNYVDYISTRAVCKSWWSAIPKKPHDL----LCRLPWLLLPH 57 Query: 219 PNLNPKRRGHF 251 NP RG + Sbjct: 58 HKDNPNHRGFY 68 >ref|XP_002510608.1| conserved hypothetical protein [Ricinus communis] gi|223551309|gb|EEF52795.1| conserved hypothetical protein [Ricinus communis] Length = 406 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/71 (39%), Positives = 41/71 (57%) Frame = +3 Query: 39 AQWSQLPKELLETITKHIDSCTDLPFVRAVCKPWRSSLPPSPHNSQRLPIINLPFPIGPN 218 + WS+LP+ELL+TIT+ + D RAVCK W S++P PH+ + LP+ + P Sbjct: 2 SNWSELPQELLQTITQKQSNYVDYISTRAVCKSWWSAIPKKPHDL----LCQLPWLLLPY 57 Query: 219 PNLNPKRRGHF 251 NP RG + Sbjct: 58 HKNNPNHRGFY 68 >ref|XP_003591727.1| F-box protein [Medicago truncatula] gi|358344561|ref|XP_003636357.1| F-box protein [Medicago truncatula] gi|355480775|gb|AES61978.1| F-box protein [Medicago truncatula] gi|355502292|gb|AES83495.1| F-box protein [Medicago truncatula] Length = 404 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/59 (45%), Positives = 38/59 (64%), Gaps = 2/59 (3%) Frame = +3 Query: 33 ISAQWSQLPKELLETITKHIDSCTDLPFVRAVCKPWRSSLPPS--PHNSQRLPIINLPF 203 ++ WS+LPK+LL I+KHIDS DL R+VC WRSS P+ P+++ P+ PF Sbjct: 1 MAVNWSELPKDLLNLISKHIDSELDLIRFRSVCSNWRSSSIPNHHPNSTIEFPLFKAPF 59