BLASTX nr result
ID: Paeonia24_contig00026564
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00026564 (295 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD17351.1| contains similarity to retrovirus-related polypro... 56 6e-06 gb|AAF79348.1|AC007887_7 F15O4.13 [Arabidopsis thaliana] 56 6e-06 >gb|AAD17351.1| contains similarity to retrovirus-related polyproteins and to CCHC zinc finger protein (Pfam: PF00098, Score=16.3, E=0.051, E= 1) [Arabidopsis thaliana] gi|7267432|emb|CAB77944.1| putative polyprotein [Arabidopsis thaliana] Length = 1138 Score = 55.8 bits (133), Expect = 6e-06 Identities = 33/63 (52%), Positives = 38/63 (60%), Gaps = 16/63 (25%) Frame = +3 Query: 42 EFCFGLPRTRRGKDSILVVVDKF---------------LH-ANLFLDGVVRYHGIPKSIV 173 +F GLPRTR GKDSI VVVD+F +H ANLF VVR HG+PK+IV Sbjct: 836 DFVVGLPRTRTGKDSIFVVVDRFSKMAHFIPCHKTDDAMHIANLFFREVVRLHGMPKTIV 895 Query: 174 YDR 182 DR Sbjct: 896 SDR 898 >gb|AAF79348.1|AC007887_7 F15O4.13 [Arabidopsis thaliana] Length = 1887 Score = 55.8 bits (133), Expect = 6e-06 Identities = 33/63 (52%), Positives = 38/63 (60%), Gaps = 16/63 (25%) Frame = +3 Query: 42 EFCFGLPRTRRGKDSILVVVDKF---------------LH-ANLFLDGVVRYHGIPKSIV 173 +F GLPRTR GKDSI VVVD+F +H ANLF VVR HG+PK+IV Sbjct: 1461 DFVVGLPRTRTGKDSIFVVVDRFSKMAHFIPCHKTDDAIHIANLFFREVVRLHGMPKTIV 1520 Query: 174 YDR 182 DR Sbjct: 1521 SDR 1523