BLASTX nr result
ID: Paeonia24_contig00026522
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00026522 (213 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_002430989.1| leucine rich protein [Escherichia sp. 3_2_53... 56 5e-06 >ref|WP_002430989.1| leucine rich protein [Escherichia sp. 3_2_53FAA] gi|226903372|gb|EEH89631.1| hypothetical protein ESAG_07156 [Escherichia sp. 3_2_53FAA] Length = 56 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/44 (63%), Positives = 30/44 (68%) Frame = -1 Query: 132 LPTKPNYILPLGQPSPSWHNLLRPSIAS*TSIGILTDFPSTTPF 1 +P KP Y L GQPSP H+LLRP A S GILT FPSTTPF Sbjct: 1 MPGKPAYTLKPGQPSPGQHSLLRPPFAVTPSTGILTCFPSTTPF 44