BLASTX nr result
ID: Paeonia24_contig00025987
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00025987 (232 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007039117.1| F-box family protein, putative isoform 1 [Th... 76 4e-12 emb|CBI23042.3| unnamed protein product [Vitis vinifera] 72 8e-11 ref|XP_002275610.1| PREDICTED: dof zinc finger protein DOF4.6-li... 72 8e-11 ref|XP_007039118.1| F-box family protein, putative isoform 2 [Th... 72 1e-10 ref|XP_007136465.1| hypothetical protein PHAVU_009G047500g [Phas... 70 3e-10 ref|XP_004502687.1| PREDICTED: dof zinc finger protein DOF4.6-li... 65 8e-09 ref|XP_002317793.2| hypothetical protein POPTR_0012s02570g [Popu... 65 1e-08 ref|XP_002321982.1| hypothetical protein POPTR_0015s01160g [Popu... 65 1e-08 gb|ACJ38096.1| Dof1 [Populus tomentosa] 65 1e-08 gb|ADL36684.1| DOF domain class transcription factor [Malus dome... 65 1e-08 ref|NP_001236777.1| Dof21 [Glycine max] gi|112363396|gb|ABI16022... 64 2e-08 ref|XP_006441159.1| hypothetical protein CICLE_v10021862mg [Citr... 64 2e-08 ref|NP_001236794.1| Dof21b [Glycine max] gi|112363398|gb|ABI1602... 64 3e-08 ref|XP_006350511.1| PREDICTED: dof zinc finger protein DOF4.6-li... 63 4e-08 ref|XP_006476324.1| PREDICTED: dof zinc finger protein DOF4.6-li... 62 1e-07 ref|XP_006476323.1| PREDICTED: dof zinc finger protein DOF4.6-li... 62 1e-07 ref|XP_006439269.1| hypothetical protein CICLE_v10021521mg [Citr... 62 1e-07 emb|CAA08755.1| Dof zinc finger protein [Nicotiana tabacum] 62 1e-07 gb|EYU45281.1| hypothetical protein MIMGU_mgv1a024208mg [Mimulus... 61 1e-07 ref|XP_007211201.1| hypothetical protein PRUPE_ppa008843mg [Prun... 61 1e-07 >ref|XP_007039117.1| F-box family protein, putative isoform 1 [Theobroma cacao] gi|508776362|gb|EOY23618.1| F-box family protein, putative isoform 1 [Theobroma cacao] Length = 273 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +1 Query: 106 MDTAQWPQGIGVVKPMDQASRSMLERRARPQKEQVLNCPRCN 231 MDTAQWPQGIGVVKPM+ ASR M+ERRARPQ +Q LNCPRCN Sbjct: 1 MDTAQWPQGIGVVKPME-ASRPMVERRARPQNDQALNCPRCN 41 >emb|CBI23042.3| unnamed protein product [Vitis vinifera] Length = 245 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +1 Query: 106 MDTAQWPQGIGVVKPMDQASRSMLERRARPQKEQVLNCPRCN 231 MDTAQWPQGIGVVKPM+ +S + ERRARPQK+Q LNCPRCN Sbjct: 1 MDTAQWPQGIGVVKPME-SSGPVAERRARPQKDQALNCPRCN 41 >ref|XP_002275610.1| PREDICTED: dof zinc finger protein DOF4.6-like [Vitis vinifera] Length = 287 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +1 Query: 106 MDTAQWPQGIGVVKPMDQASRSMLERRARPQKEQVLNCPRCN 231 MDTAQWPQGIGVVKPM+ +S + ERRARPQK+Q LNCPRCN Sbjct: 1 MDTAQWPQGIGVVKPME-SSGPVAERRARPQKDQALNCPRCN 41 >ref|XP_007039118.1| F-box family protein, putative isoform 2 [Theobroma cacao] gi|508776363|gb|EOY23619.1| F-box family protein, putative isoform 2 [Theobroma cacao] Length = 229 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 1/43 (2%) Frame = +1 Query: 106 MDTAQWPQ-GIGVVKPMDQASRSMLERRARPQKEQVLNCPRCN 231 MDTAQWPQ GIGVVKPM+ ASR M+ERRARPQ +Q LNCPRCN Sbjct: 1 MDTAQWPQQGIGVVKPME-ASRPMVERRARPQNDQALNCPRCN 42 >ref|XP_007136465.1| hypothetical protein PHAVU_009G047500g [Phaseolus vulgaris] gi|561009552|gb|ESW08459.1| hypothetical protein PHAVU_009G047500g [Phaseolus vulgaris] Length = 278 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/43 (76%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = +1 Query: 106 MDTAQWPQGIGVVKPMDQASRS-MLERRARPQKEQVLNCPRCN 231 MDTAQW QGIGVVKPM+ + MLERRARPQK+Q LNCPRCN Sbjct: 1 MDTAQWAQGIGVVKPMEGSKPPPMLERRARPQKDQALNCPRCN 43 >ref|XP_004502687.1| PREDICTED: dof zinc finger protein DOF4.6-like isoform X1 [Cicer arietinum] Length = 325 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/45 (68%), Positives = 34/45 (75%), Gaps = 3/45 (6%) Frame = +1 Query: 106 MDTAQWPQGIGVVKPMDQASRS---MLERRARPQKEQVLNCPRCN 231 MDT+QW QGIGVVK M+ MLERRARPQK+Q LNCPRCN Sbjct: 1 MDTSQWAQGIGVVKQMENPCSKEAPMLERRARPQKDQALNCPRCN 45 >ref|XP_002317793.2| hypothetical protein POPTR_0012s02570g [Populus trichocarpa] gi|550326227|gb|EEE96013.2| hypothetical protein POPTR_0012s02570g [Populus trichocarpa] Length = 297 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/43 (69%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = +1 Query: 106 MDTA-QWPQGIGVVKPMDQASRSMLERRARPQKEQVLNCPRCN 231 MDTA QW QGIG V PM+ + +LERRARPQK+Q LNCPRCN Sbjct: 1 MDTATQWAQGIGAVNPMEGSRPDVLERRARPQKDQALNCPRCN 43 >ref|XP_002321982.1| hypothetical protein POPTR_0015s01160g [Populus trichocarpa] gi|222868978|gb|EEF06109.1| hypothetical protein POPTR_0015s01160g [Populus trichocarpa] Length = 255 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 106 MDTA-QWPQGIGVVKPMDQASRSMLERRARPQKEQVLNCPRC 228 MDT+ QWPQGIGVVKP++ MLERRARPQKEQ LNCPRC Sbjct: 1 MDTSTQWPQGIGVVKPVE--GPDMLERRARPQKEQALNCPRC 40 >gb|ACJ38096.1| Dof1 [Populus tomentosa] Length = 255 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 106 MDTA-QWPQGIGVVKPMDQASRSMLERRARPQKEQVLNCPRC 228 MDT+ QWPQGIGVVKP++ MLERRARPQKEQ LNCPRC Sbjct: 1 MDTSTQWPQGIGVVKPVE--GPEMLERRARPQKEQALNCPRC 40 >gb|ADL36684.1| DOF domain class transcription factor [Malus domestica] Length = 315 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/51 (64%), Positives = 38/51 (74%), Gaps = 9/51 (17%) Frame = +1 Query: 106 MDTAQWPQGIGVVKPMDQ---------ASRSMLERRARPQKEQVLNCPRCN 231 MDTAQWPQGI VVKP+D+ A+ + LER+ARPQKEQ LNCPRCN Sbjct: 1 MDTAQWPQGI-VVKPIDEIVTNSCPKPAAANNLERKARPQKEQALNCPRCN 50 >ref|NP_001236777.1| Dof21 [Glycine max] gi|112363396|gb|ABI16022.1| Dof21 [Glycine max] Length = 297 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/49 (65%), Positives = 35/49 (71%), Gaps = 7/49 (14%) Frame = +1 Query: 106 MDTAQWPQGIGVVKPMDQASRS-------MLERRARPQKEQVLNCPRCN 231 MDTAQW QGIGVVK + S+ MLERRARPQK+Q LNCPRCN Sbjct: 1 MDTAQWAQGIGVVKQPMEGSKPPPPPPPPMLERRARPQKDQALNCPRCN 49 >ref|XP_006441159.1| hypothetical protein CICLE_v10021862mg [Citrus clementina] gi|568877934|ref|XP_006491972.1| PREDICTED: dof zinc finger protein DOF4.6-like [Citrus sinensis] gi|557543421|gb|ESR54399.1| hypothetical protein CICLE_v10021862mg [Citrus clementina] Length = 249 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/43 (67%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = +1 Query: 106 MDTA-QWPQGIGVVKPMDQASRSMLERRARPQKEQVLNCPRCN 231 MDTA WPQGIG V PM+ S LERR +PQ+E+VLNCPRCN Sbjct: 1 MDTAYHWPQGIGFVTPMEAGSNPTLERRPKPQRERVLNCPRCN 43 >ref|NP_001236794.1| Dof21b [Glycine max] gi|112363398|gb|ABI16023.1| Dof28 [Glycine max] Length = 306 Score = 63.5 bits (153), Expect = 3e-08 Identities = 33/48 (68%), Positives = 36/48 (75%), Gaps = 6/48 (12%) Frame = +1 Query: 106 MDTAQWPQGIGVVKP--MDQASRS----MLERRARPQKEQVLNCPRCN 231 MDTAQW QGIGVVK M+ S+ MLERRARPQK+Q LNCPRCN Sbjct: 1 MDTAQWAQGIGVVKQPTMEGGSKPPPPPMLERRARPQKDQALNCPRCN 48 >ref|XP_006350511.1| PREDICTED: dof zinc finger protein DOF4.6-like [Solanum tuberosum] Length = 261 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/43 (62%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = +1 Query: 106 MDTA-QWPQGIGVVKPMDQASRSMLERRARPQKEQVLNCPRCN 231 MDT+ QWPQGIG+VK +D+ S + +R+ RPQKEQ +NCPRCN Sbjct: 1 MDTSSQWPQGIGIVKGVDETSSKLDQRKPRPQKEQAVNCPRCN 43 >ref|XP_006476324.1| PREDICTED: dof zinc finger protein DOF4.6-like isoform X2 [Citrus sinensis] Length = 285 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/51 (62%), Positives = 37/51 (72%), Gaps = 9/51 (17%) Frame = +1 Query: 106 MDTAQWPQGIGVVKPMDQ---------ASRSMLERRARPQKEQVLNCPRCN 231 MDTAQWPQ I VVKP+++ AS + LER+ARPQKEQ LNCPRCN Sbjct: 1 MDTAQWPQEI-VVKPIEEIVTNTCPKPASAAALERKARPQKEQALNCPRCN 50 >ref|XP_006476323.1| PREDICTED: dof zinc finger protein DOF4.6-like isoform X1 [Citrus sinensis] Length = 288 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/51 (62%), Positives = 37/51 (72%), Gaps = 9/51 (17%) Frame = +1 Query: 106 MDTAQWPQGIGVVKPMDQ---------ASRSMLERRARPQKEQVLNCPRCN 231 MDTAQWPQ I VVKP+++ AS + LER+ARPQKEQ LNCPRCN Sbjct: 1 MDTAQWPQEI-VVKPIEEIVTNTCPKPASAAALERKARPQKEQALNCPRCN 50 >ref|XP_006439269.1| hypothetical protein CICLE_v10021521mg [Citrus clementina] gi|557541531|gb|ESR52509.1| hypothetical protein CICLE_v10021521mg [Citrus clementina] Length = 285 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/51 (62%), Positives = 37/51 (72%), Gaps = 9/51 (17%) Frame = +1 Query: 106 MDTAQWPQGIGVVKPMDQ---------ASRSMLERRARPQKEQVLNCPRCN 231 MDTAQWPQ I VVKP+++ AS + LER+ARPQKEQ LNCPRCN Sbjct: 1 MDTAQWPQEI-VVKPIEEIVTNTCPKPASAAALERKARPQKEQALNCPRCN 50 >emb|CAA08755.1| Dof zinc finger protein [Nicotiana tabacum] Length = 262 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = +1 Query: 106 MDTAQWPQGIGVVKPMDQASRSMLERRARPQKEQVLNCPRCN 231 MDT+ WPQGIG+VK ++ + ER+ RPQKEQ +NCPRCN Sbjct: 1 MDTSHWPQGIGLVKAVEPSKPVPTERKPRPQKEQAINCPRCN 42 >gb|EYU45281.1| hypothetical protein MIMGU_mgv1a024208mg [Mimulus guttatus] Length = 309 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/46 (58%), Positives = 36/46 (78%), Gaps = 4/46 (8%) Frame = +1 Query: 106 MDTAQWPQGIGVVKPMDQASRSM----LERRARPQKEQVLNCPRCN 231 MDTAQWPQGIGVVK ++ S+S+ +E++ RP K+Q +NCPRCN Sbjct: 1 MDTAQWPQGIGVVKAVEDNSKSINGGHVEKKPRPDKDQPVNCPRCN 46 >ref|XP_007211201.1| hypothetical protein PRUPE_ppa008843mg [Prunus persica] gi|462406936|gb|EMJ12400.1| hypothetical protein PRUPE_ppa008843mg [Prunus persica] Length = 317 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 12/54 (22%) Frame = +1 Query: 106 MDTAQWPQGIGVVKPMDQ------------ASRSMLERRARPQKEQVLNCPRCN 231 MDTAQWPQGI VVKP+++ A+ + LER+ARPQKEQ LNCPRCN Sbjct: 1 MDTAQWPQGI-VVKPIEEIVTNTCPKPAAAAAVNNLERKARPQKEQALNCPRCN 53