BLASTX nr result
ID: Paeonia24_contig00024581
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00024581 (290 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006841194.1| hypothetical protein AMTR_s00334p00011530 [A... 168 6e-40 pir||T14570 cytochrome b559 component psbE - beet chloroplast gi... 138 7e-31 ref|XP_004162281.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome b... 127 4e-30 ref|XP_004228904.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome b... 134 1e-29 ref|YP_008757458.1| cytochrome b559 subunit alpha (chloroplast) ... 129 5e-28 ref|XP_006404486.1| hypothetical protein EUTSA_v10011089mg, part... 127 2e-27 gb|AER45593.1| psbE (chloroplast) [Halocarpus kirkii] 119 3e-25 ref|YP_006665797.1| photosystem II cytochrome b559 alpha subunit... 117 2e-24 gb|AAM53426.1| PsbE [Cuscuta gronovii] 117 2e-24 ref|YP_008993193.1| photosystem II cytochrome b559 alpha subunit... 117 2e-24 gb|AHA12699.1| photosystem II cytochrome b559 alpha subunit [Orc... 117 2e-24 gb|AGQ55692.1| photosystem II protein V (chloroplast) [Alstroeme... 117 2e-24 gb|AGW04683.1| photosystem II protein V [Matelea biflora] 117 2e-24 gb|EPS73280.1| cytochrome b559 subunit alpha, partial [Genlisea ... 117 2e-24 ref|YP_008378800.1| photosystem II protein V (chloroplast) [Naja... 117 2e-24 ref|XP_004987318.1| PREDICTED: cytochrome b559 subunit alpha-lik... 117 2e-24 ref|YP_007475978.1| photosystem II cytochrome b559 alpha subunit... 117 2e-24 gb|AGC38262.1| photosystem II protein V (chloroplast) [Cryptochl... 117 2e-24 ref|YP_358595.1| photosystem II protein V [Phalaenopsis aphrodit... 117 2e-24 ref|YP_398346.1| photosystem II protein V [Lactuca sativa] gi|94... 117 2e-24 >ref|XP_006841194.1| hypothetical protein AMTR_s00334p00011530 [Amborella trichopoda] gi|548843101|gb|ERN02869.1| hypothetical protein AMTR_s00334p00011530 [Amborella trichopoda] Length = 162 Score = 168 bits (426), Expect = 6e-40 Identities = 82/96 (85%), Positives = 86/96 (89%) Frame = +2 Query: 2 TLGTILTILQRFYFDEFPFTDLIF*EIDPPLTVQEYVEISMSGSTGERSFADIITNIRYW 181 TLGT+LTI QR F EF FTD IF +DPPLTVQEY E+ MSGSTGERSFADIIT+IRYW Sbjct: 40 TLGTLLTISQRSDFSEFLFTDFIFYGVDPPLTVQEYAELKMSGSTGERSFADIITSIRYW 99 Query: 182 VIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 289 VIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF Sbjct: 100 VIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 135 >pir||T14570 cytochrome b559 component psbE - beet chloroplast gi|860891|emb|CAA60967.1| PSII cytochome b559 alpha chain [Beta vulgaris subsp. vulgaris] gi|860897|emb|CAA60972.1| PSII cytochrome b599 alpha chain [Beta vulgaris subsp. vulgaris] Length = 118 Score = 138 bits (348), Expect = 7e-31 Identities = 66/69 (95%), Positives = 68/69 (98%) Frame = +2 Query: 83 DPPLTVQEYVEISMSGSTGERSFADIITNIRYWVIHSITIPSLFIAGWLFVSTGLAYDVF 262 D PLTVQEYVE+SMSGSTGERSFADIIT+IRYWVIHSITIPSLFIAGWLFVSTGLAYDVF Sbjct: 23 DLPLTVQEYVELSMSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVF 82 Query: 263 GSPRPNEYF 289 GSPRPNEYF Sbjct: 83 GSPRPNEYF 91 >ref|XP_004162281.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome b559 subunit alpha-like [Cucumis sativus] Length = 132 Score = 127 bits (318), Expect(2) = 4e-30 Identities = 64/73 (87%), Positives = 66/73 (90%) Frame = +2 Query: 71 F*EIDPPLTVQEYVEISMSGSTGERSFADIITNIRYWVIHSITIPSLFIAGWLFVSTGLA 250 F E P LTVQEYVE+ MSGSTGERSFADIIT+IRYWVIHS IPSLFIAGWLFVSTGLA Sbjct: 34 FTESIPLLTVQEYVELGMSGSTGERSFADIITSIRYWVIHS-XIPSLFIAGWLFVSTGLA 92 Query: 251 YDVFGSPRPNEYF 289 YDVFGSPRPNEYF Sbjct: 93 YDVFGSPRPNEYF 105 Score = 30.0 bits (66), Expect(2) = 4e-30 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +3 Query: 39 ISTNFHLPISSFKKSIPL 92 IS NFHL ISSF +SIPL Sbjct: 23 ISVNFHLLISSFTESIPL 40 >ref|XP_004228904.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome b559 subunit alpha-like [Solanum lycopersicum] Length = 116 Score = 134 bits (338), Expect = 1e-29 Identities = 64/66 (96%), Positives = 66/66 (100%) Frame = +2 Query: 92 LTVQEYVEISMSGSTGERSFADIITNIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSP 271 LTVQEYVE+SMSGSTGERSFADIIT+IRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSP Sbjct: 24 LTVQEYVELSMSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSP 83 Query: 272 RPNEYF 289 RPNEYF Sbjct: 84 RPNEYF 89 >ref|YP_008757458.1| cytochrome b559 subunit alpha (chloroplast) [Oryza rufipogon] gi|42795499|gb|AAS46066.1| cytochrome b559 alpha chain [Oryza sativa Indica Group] gi|42795566|gb|AAS46132.1| cytochrome b559 alpha chain [Oryza sativa Japonica Group] gi|42795630|gb|AAS46195.1| cytochrome b559 alpha chain [Oryza sativa Japonica Group] gi|290790587|gb|ADD62847.1| photosystem II cytochrome b559 alpha subunit [Oryza sativa Japonica Group] gi|290790656|gb|ADD62915.1| photosystem II cytochrome b559 alpha subunit [Oryza meridionalis] gi|290790725|gb|ADD62983.1| photosystem II cytochrome b559 alpha subunit [Oryza australiensis] gi|290790794|gb|ADD63051.1| photosystem II cytochrome b559 alpha subunit [Potamophila parviflora] gi|290790861|gb|ADD63117.1| photosystem II cytochrome b559 alpha subunit [Microlaena stipoides] gi|552954496|gb|AGY48964.1| cytochrome b559 subunit alpha (chloroplast) [Oryza rufipogon] Length = 104 Score = 129 bits (323), Expect = 5e-28 Identities = 63/73 (86%), Positives = 67/73 (91%) Frame = +2 Query: 71 F*EIDPPLTVQEYVEISMSGSTGERSFADIITNIRYWVIHSITIPSLFIAGWLFVSTGLA 250 F E P L VQ++ E+SMSGSTGERSFADIIT+IRYWVIHSITIPSLFIAGWLFVSTGLA Sbjct: 5 FTESIPFLNVQKFGELSMSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLA 64 Query: 251 YDVFGSPRPNEYF 289 YDVFGSPRPNEYF Sbjct: 65 YDVFGSPRPNEYF 77 >ref|XP_006404486.1| hypothetical protein EUTSA_v10011089mg, partial [Eutrema salsugineum] gi|557105605|gb|ESQ45939.1| hypothetical protein EUTSA_v10011089mg, partial [Eutrema salsugineum] Length = 94 Score = 127 bits (318), Expect = 2e-27 Identities = 59/65 (90%), Positives = 64/65 (98%) Frame = +2 Query: 95 TVQEYVEISMSGSTGERSFADIITNIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPR 274 +++EY+E SMSGSTGERSFADIIT+IRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPR Sbjct: 3 SLREYLEFSMSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPR 62 Query: 275 PNEYF 289 PNEYF Sbjct: 63 PNEYF 67 >gb|AER45593.1| psbE (chloroplast) [Halocarpus kirkii] Length = 87 Score = 119 bits (299), Expect = 3e-25 Identities = 55/60 (91%), Positives = 60/60 (100%) Frame = +2 Query: 110 VEISMSGSTGERSFADIITNIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 289 +E+SMSG+TGER+FADIIT+IRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF Sbjct: 1 MELSMSGNTGERAFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 60 >ref|YP_006665797.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Elodea canadensis] gi|456061468|ref|YP_007475636.1| photosystem II cytochrome b559 alpha subunit [Heliconia collinsiana] gi|511943388|ref|YP_008081667.1| cytochrome b559 alpha chain (chloroplast) [Cymbidium sinense] gi|511943501|ref|YP_008081823.1| cytochrome b559 alpha chain (chloroplast) [Cymbidium tracyanum] gi|512721449|ref|YP_008081745.1| cytochrome b559 alpha chain (chloroplast) [Cymbidium tortisepalum] gi|556927249|ref|YP_008758205.1| cytochrome b559 alpha chain (chloroplast) [Veratrum patulum] gi|563940569|ref|YP_008854442.1| photosystem II cytochrome b559 alpha subunit [Musa textilis] gi|563940671|ref|YP_008854527.1| photosystem II cytochrome b559 alpha subunit [Ravenala madagascariensis] gi|618750318|ref|YP_009026454.1| photosystem II protein V (chloroplast) [Dendrobium officinale] gi|548610|sp|P36442.2|PSBE_MESCR RecName: Full=Cytochrome b559 subunit alpha; AltName: Full=PSII reaction center subunit V gi|437300|gb|AAA21857.1| cytochrome b-559 alpha subunit [Mesembryanthemum crystallinum] gi|156598315|gb|ABU85418.1| photosystem II cytochrome b559 alpha subunit [Musa acuminata] gi|374094613|gb|AEY84669.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Elodea canadensis] gi|374974833|gb|AFA27508.1| photosystem II cytochrome b559 alpha subunit, partial [Flagellaria indica] gi|374974849|gb|AFA27516.1| photosystem II cytochrome b559 alpha subunit, partial [Kingia australis] gi|374974887|gb|AFA27535.1| photosystem II cytochrome b559 alpha subunit, partial [Thurnia sphaerocephala] gi|392841355|gb|AFM83310.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Kingia australis] gi|408903948|gb|AFU96558.1| PsbE, partial (chloroplast) [Chrysobalanus icaco] gi|408903958|gb|AFU96563.1| PsbE, partial (chloroplast) [Euphorbia maculata] gi|408903978|gb|AFU96573.1| PsbE, partial (chloroplast) [Linum usitatissimum] gi|449326115|gb|AGE92701.1| photosystem II cytochrome b559 alpha subunit [Heliconia collinsiana] gi|449326896|gb|AGE93473.1| photosystem II cytochrome b559 alpha subunit [Xiphidium caeruleum] gi|482662138|gb|AGK25366.1| cytochrome b559 alpha chain (chloroplast) [Cymbidium sinense] gi|482662217|gb|AGK25444.1| cytochrome b559 alpha chain (chloroplast) [Cymbidium tortisepalum] gi|482662296|gb|AGK25522.1| cytochrome b559 alpha chain (chloroplast) [Cymbidium tortisepalum] gi|482662454|gb|AGK25678.1| cytochrome b559 alpha chain (chloroplast) [Cymbidium tracyanum] gi|482662533|gb|AGK25756.1| cytochrome b559 alpha chain (chloroplast) [Cymbidium tortisepalum] gi|507474336|gb|AGM48212.1| photosystem II protein V (chloroplast) [Dendrobium officinale] gi|525312474|emb|CCW72392.1| psbF (chloroplast) [Musa acuminata subsp. malaccensis] gi|549531734|gb|AGX28860.1| cytochrome b559 alpha chain (chloroplast) [Veratrum patulum] gi|557636929|gb|AHA12531.1| photosystem II cytochrome b559 alpha subunit [Musa textilis] gi|557637015|gb|AHA12616.1| photosystem II cytochrome b559 alpha subunit [Ravenala madagascariensis] gi|557637173|gb|AHA12772.1| photosystem II cytochrome b559 alpha subunit [Canna indica] gi|557637257|gb|AHA12855.1| photosystem II cytochrome b559 alpha subunit [Maranta leuconeura] gi|557637344|gb|AHA12941.1| photosystem II cytochrome b559 alpha subunit [Monocostus uniflorus] gi|557637431|gb|AHA13027.1| photosystem II cytochrome b559 alpha subunit [Costus pulverulentus] gi|557637605|gb|AHA13199.1| photosystem II cytochrome b559 alpha subunit [Thaumatococcus daniellii] Length = 83 Score = 117 bits (293), Expect = 2e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = +2 Query: 122 MSGSTGERSFADIITNIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 289 MSGSTGERSFADIIT+IRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF Sbjct: 1 MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 56 >gb|AAM53426.1| PsbE [Cuscuta gronovii] Length = 84 Score = 117 bits (293), Expect = 2e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = +2 Query: 122 MSGSTGERSFADIITNIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 289 MSGSTGERSFADIIT+IRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF Sbjct: 1 MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 56 >ref|YP_008993193.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Magnolia cathcartii] Length = 83 Score = 117 bits (293), Expect = 2e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = +2 Query: 122 MSGSTGERSFADIITNIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 289 MSGSTGERSFADIIT+IRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF Sbjct: 1 MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 56 >gb|AHA12699.1| photosystem II cytochrome b559 alpha subunit [Orchidantha fimbriata] Length = 83 Score = 117 bits (293), Expect = 2e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = +2 Query: 122 MSGSTGERSFADIITNIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 289 MSGSTGERSFADIIT+IRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF Sbjct: 1 MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 56 >gb|AGQ55692.1| photosystem II protein V (chloroplast) [Alstroemeria aurea] Length = 83 Score = 117 bits (293), Expect = 2e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = +2 Query: 122 MSGSTGERSFADIITNIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 289 MSGSTGERSFADIIT+IRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF Sbjct: 1 MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 56 >gb|AGW04683.1| photosystem II protein V [Matelea biflora] Length = 83 Score = 117 bits (293), Expect = 2e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = +2 Query: 122 MSGSTGERSFADIITNIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 289 MSGSTGERSFADIIT+IRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF Sbjct: 1 MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 56 >gb|EPS73280.1| cytochrome b559 subunit alpha, partial [Genlisea aurea] Length = 95 Score = 117 bits (293), Expect = 2e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = +2 Query: 122 MSGSTGERSFADIITNIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 289 MSGSTGERSFADIIT+IRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF Sbjct: 1 MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 56 >ref|YP_008378800.1| photosystem II protein V (chloroplast) [Najas flexilis] gi|427920131|gb|AFY64162.1| photosystem II protein V (chloroplast) [Najas flexilis] Length = 83 Score = 117 bits (293), Expect = 2e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = +2 Query: 122 MSGSTGERSFADIITNIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 289 MSGSTGERSFADIIT+IRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF Sbjct: 1 MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 56 >ref|XP_004987318.1| PREDICTED: cytochrome b559 subunit alpha-like [Setaria italica] gi|514825361|ref|XP_004987334.1| PREDICTED: cytochrome b559 subunit alpha-like [Setaria italica] Length = 136 Score = 117 bits (293), Expect = 2e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = +2 Query: 122 MSGSTGERSFADIITNIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 289 MSGSTGERSFADIIT+IRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF Sbjct: 1 MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 56 >ref|YP_007475978.1| photosystem II cytochrome b559 alpha subunit [Bismarckia nobilis] gi|449326461|gb|AGE93043.1| photosystem II cytochrome b559 alpha subunit [Bismarckia nobilis] Length = 83 Score = 117 bits (293), Expect = 2e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = +2 Query: 122 MSGSTGERSFADIITNIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 289 MSGSTGERSFADIIT+IRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF Sbjct: 1 MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 56 >gb|AGC38262.1| photosystem II protein V (chloroplast) [Cryptochloa strictiflora] Length = 87 Score = 117 bits (293), Expect = 2e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = +2 Query: 122 MSGSTGERSFADIITNIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 289 MSGSTGERSFADIIT+IRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF Sbjct: 1 MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 56 >ref|YP_358595.1| photosystem II protein V [Phalaenopsis aphrodite subsp. formosana] gi|94730458|sp|Q3BAM3.1|PSBE_PHAAO RecName: Full=Cytochrome b559 subunit alpha; AltName: Full=PSII reaction center subunit V gi|58802797|gb|AAW82517.1| cytochrome b559 alpha chain [Phalaenopsis aphrodite subsp. formosana] Length = 83 Score = 117 bits (293), Expect = 2e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = +2 Query: 122 MSGSTGERSFADIITNIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 289 MSGSTGERSFADIIT+IRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF Sbjct: 1 MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 56 >ref|YP_398346.1| photosystem II protein V [Lactuca sativa] gi|94502508|ref|YP_588134.1| photosystem II protein V (chloroplast) [Helianthus annuus] gi|183217758|ref|YP_001837377.1| photosystem II protein V [Guizotia abyssinica] gi|334701819|ref|YP_004564389.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Ageratina adenophora] gi|334702341|ref|YP_004465204.1| photosystem II cytochrome b559 alpha subunit [Jacobaea vulgaris] gi|342316138|ref|YP_004769647.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Spirodela polyrhiza] gi|342316307|ref|YP_004769829.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Wolffiella lingulata] gi|374249721|ref|YP_005089351.1| psbE gene product (chloroplast) [Silene vulgaris] gi|374249804|ref|YP_005089432.1| psbE gene product (chloroplast) [Silene noctiflora] gi|374249885|ref|YP_005089513.1| psbE gene product (chloroplast) [Silene conica] gi|374249967|ref|YP_005089594.1| psbE gene product (chloroplast) [Silene latifolia] gi|377819395|ref|YP_005097891.1| photosystem II protein V (chloroplast) [Colocasia esculenta] gi|441403309|ref|YP_007353783.1| photosystem II protein V (chloroplast) [Chrysanthemum x morifolium] gi|452849068|ref|YP_007474746.1| photosystem II protein V (chloroplast) [Chrysanthemum indicum] gi|470227725|ref|YP_007624812.1| cytochrome b559 component alpha chain (chloroplast) [Artemisia frigida] gi|568245224|ref|YP_008964374.1| photosystem II cytochrome b559 alpha subunit [Helianthus divaricatus] gi|568245310|ref|YP_008964459.1| photosystem II cytochrome b559 alpha subunit [Helianthus decapetalus] gi|568245396|ref|YP_008964714.1| photosystem II cytochrome b559 alpha subunit [Helianthus strumosus] gi|568245482|ref|YP_008964799.1| photosystem II cytochrome b559 alpha subunit [Helianthus maximiliani] gi|568247174|ref|YP_008964204.1| photosystem II cytochrome b559 alpha subunit [Helianthus giganteus] gi|568247260|ref|YP_008964289.1| photosystem II cytochrome b559 alpha subunit [Helianthus grosseserratus] gi|568247346|ref|YP_008964544.1| photosystem II cytochrome b559 alpha subunit [Helianthus hirsutus] gi|568247432|ref|YP_008964629.1| photosystem II cytochrome b559 alpha subunit [Helianthus tuberosus] gi|575925647|ref|YP_009000032.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Silene conoidea] gi|576303633|ref|YP_008999952.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Agrostemma githago] gi|576312309|ref|YP_009000193.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Silene paradoxa] gi|576999565|ref|YP_009000114.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Silene chalcedonica] gi|598324142|ref|YP_009020760.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Praxelis clematidea] gi|94730455|sp|Q332W1.1|PSBE_LACSA RecName: Full=Cytochrome b559 subunit alpha; AltName: Full=PSII reaction center subunit V gi|122179565|sp|Q1KXU2.1|PSBE_HELAN RecName: Full=Cytochrome b559 subunit alpha; AltName: Full=PSII reaction center subunit V gi|78675185|dbj|BAE47611.1| cytochrome b559 component alpha chain [Lactuca sativa] gi|88656912|gb|ABD47163.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Helianthus annuus] gi|88657000|gb|ABD47250.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Lactuca sativa] gi|156598618|gb|ABU85565.1| photosystem II cytochrome b559 alpha subunit [Scaevola aemula] gi|166235542|gb|ABY85457.1| PSII reaction centre subunit V [Silene chalcedonica] gi|166235564|gb|ABY85478.1| PSII reaction centre subunit V [Silene samia] gi|166235608|gb|ABY85520.1| PSII reaction centre subunit V [Silene uniflora] gi|166235630|gb|ABY85541.1| PSII reaction centre subunit V [Silene zawadskii] gi|166235652|gb|ABY85562.1| PSII reaction centre subunit V [Silene sorensenis] gi|166235674|gb|ABY85583.1| PSII reaction centre subunit V [Silene integripetala] gi|166235696|gb|ABY85604.1| PSII reaction centre subunit V [Silene conica] gi|166235718|gb|ABY85625.1| PSII reaction centre subunit V [Silene latifolia] gi|166235740|gb|ABY85646.1| PSII reaction centre subunit V [Silene cryptoneura] gi|166235762|gb|ABY85667.1| PSII reaction centre subunit V [Silene sordida] gi|166235784|gb|ABY85688.1| PSII reaction centre subunit V [Silene fruticosa] gi|166235806|gb|ABY85709.1| PSII reaction centre subunit V [Silene pseudoatocion] gi|166235828|gb|ABY85730.1| PSII reaction centre subunit V [Silene schafta] gi|166235850|gb|ABY85751.1| PSII reaction centre subunit V [Silene aegyptiaca] gi|166239991|gb|ABY86518.1| PSII reaction centre subunit V [Heliosperma alpestre] gi|179366273|gb|ACB86544.1| photosystem II cytochrome b559 alpha subunit [Guizotia abyssinica] gi|255709073|gb|ACU30445.1| PSII reaction center subunit V [Silene noctiflora] gi|308156099|gb|ADO15427.1| photosystem II cytochrome b559 alpha subunit [Jacobaea vulgaris] gi|329755456|gb|AEC04020.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Silene conica] gi|329755538|gb|AEC04101.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Silene latifolia] gi|329755621|gb|AEC04183.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Silene noctiflora] gi|329755703|gb|AEC04264.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Silene vulgaris] gi|334089690|gb|AEG64573.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Ageratina adenophora] gi|340536656|gb|AEK48423.1| photosystem II protein V (chloroplast) [Colocasia esculenta] gi|340536743|gb|AEK48509.1| photosystem II protein V (chloroplast) [Colocasia esculenta] gi|341834088|gb|AEK94359.1| photosystem II cytochrome b559 alpha subunit [Spirodela polyrhiza] gi|341834172|gb|AEK94442.1| photosystem II cytochrome b559 alpha subunit [Wolffiella lingulata] gi|372483896|gb|AEX95590.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Aphyllanthes monspeliensis] gi|372863223|gb|AEX99295.1| photosystem II protein V (chloroplast) [Chrysanthemum indicum] gi|372863462|gb|AEX99531.1| photosystem II protein V (chloroplast) [Chrysanthemum indicum] gi|375298852|gb|AFA45291.1| photosystem II protein V (chloroplast) [Chrysanthemum x morifolium] gi|401712213|gb|AFP98838.1| cytochrome b559 component alpha chain (chloroplast) [Artemisia frigida] gi|555944038|gb|AGZ17942.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Agrostemma githago] gi|555944119|gb|AGZ18022.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Silene conoidea] gi|555944202|gb|AGZ18104.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Silene chalcedonica] gi|555944282|gb|AGZ18183.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Silene paradoxa] gi|559768032|gb|AHB14474.1| photosystem II cytochrome b559 alpha subunit [Helianthus giganteus] gi|559768118|gb|AHB14559.1| photosystem II cytochrome b559 alpha subunit [Helianthus giganteus] gi|559768204|gb|AHB14644.1| photosystem II cytochrome b559 alpha subunit [Helianthus giganteus] gi|559768290|gb|AHB14729.1| photosystem II cytochrome b559 alpha subunit [Helianthus giganteus] gi|559768376|gb|AHB14814.1| photosystem II cytochrome b559 alpha subunit [Helianthus grosseserratus] gi|559768462|gb|AHB14899.1| photosystem II cytochrome b559 alpha subunit [Helianthus grosseserratus] gi|559768548|gb|AHB14984.1| photosystem II cytochrome b559 alpha subunit [Helianthus divaricatus] gi|559768634|gb|AHB15069.1| photosystem II cytochrome b559 alpha subunit [Helianthus divaricatus] gi|559768720|gb|AHB15154.1| photosystem II cytochrome b559 alpha subunit [Helianthus divaricatus] gi|559768806|gb|AHB15239.1| photosystem II cytochrome b559 alpha subunit [Helianthus divaricatus] gi|559768892|gb|AHB15324.1| photosystem II cytochrome b559 alpha subunit [Helianthus decapetalus] gi|559768978|gb|AHB15409.1| photosystem II cytochrome b559 alpha subunit [Helianthus decapetalus] gi|559769064|gb|AHB15494.1| photosystem II cytochrome b559 alpha subunit [Helianthus decapetalus] gi|559769150|gb|AHB15579.1| photosystem II cytochrome b559 alpha subunit [Helianthus hirsutus] gi|559769236|gb|AHB15664.1| photosystem II cytochrome b559 alpha subunit [Helianthus hirsutus] gi|559769322|gb|AHB15749.1| photosystem II cytochrome b559 alpha subunit [Helianthus tuberosus] gi|559769408|gb|AHB15834.1| photosystem II cytochrome b559 alpha subunit [Helianthus tuberosus] gi|559769494|gb|AHB15919.1| photosystem II cytochrome b559 alpha subunit [Helianthus tuberosus] gi|559769580|gb|AHB16004.1| photosystem II cytochrome b559 alpha subunit [Helianthus divaricatus] gi|559769666|gb|AHB16089.1| photosystem II cytochrome b559 alpha subunit [Helianthus giganteus] gi|559769752|gb|AHB16174.1| photosystem II cytochrome b559 alpha subunit [Helianthus giganteus] gi|559769838|gb|AHB16259.1| photosystem II cytochrome b559 alpha subunit [Helianthus grosseserratus] gi|559769924|gb|AHB16344.1| photosystem II cytochrome b559 alpha subunit [Helianthus grosseserratus] gi|559770010|gb|AHB16429.1| photosystem II cytochrome b559 alpha subunit [Helianthus grosseserratus] gi|559770096|gb|AHB16514.1| photosystem II cytochrome b559 alpha subunit [Helianthus grosseserratus] gi|559770182|gb|AHB16599.1| photosystem II cytochrome b559 alpha subunit [Helianthus decapetalus] gi|559770268|gb|AHB16684.1| photosystem II cytochrome b559 alpha subunit [Helianthus decapetalus] gi|559770354|gb|AHB16769.1| photosystem II cytochrome b559 alpha subunit [Helianthus decapetalus] gi|559770440|gb|AHB16854.1| photosystem II cytochrome b559 alpha subunit [Helianthus hirsutus] gi|559770526|gb|AHB16939.1| photosystem II cytochrome b559 alpha subunit [Helianthus hirsutus] gi|559770612|gb|AHB17024.1| photosystem II cytochrome b559 alpha subunit [Helianthus strumosus] gi|559770698|gb|AHB17109.1| photosystem II cytochrome b559 alpha subunit [Helianthus tuberosus] gi|559770784|gb|AHB17194.1| photosystem II cytochrome b559 alpha subunit [Helianthus tuberosus] gi|559770870|gb|AHB17279.1| photosystem II cytochrome b559 alpha subunit [Helianthus tuberosus] gi|559770956|gb|AHB17364.1| photosystem II cytochrome b559 alpha subunit [Helianthus maximiliani] gi|559771042|gb|AHB17449.1| photosystem II cytochrome b559 alpha subunit [Helianthus maximiliani] gi|559771128|gb|AHB17534.1| photosystem II cytochrome b559 alpha subunit [Helianthus maximiliani] gi|559771214|gb|AHB17619.1| photosystem II cytochrome b559 alpha subunit [Helianthus maximiliani] gi|594543339|gb|AHM02420.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Praxelis clematidea] Length = 83 Score = 117 bits (293), Expect = 2e-24 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = +2 Query: 122 MSGSTGERSFADIITNIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 289 MSGSTGERSFADIIT+IRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF Sbjct: 1 MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 56